DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHRNB3 and nAChRbeta1

DIOPT Version :9

Sequence 1:NP_000740.1 Gene:CHRNB3 / 1142 HGNCID:1963 Length:458 Species:Homo sapiens
Sequence 2:NP_523927.2 Gene:nAChRbeta1 / 38545 FlyBaseID:FBgn0000038 Length:521 Species:Drosophila melanogaster


Alignment Length:501 Identity:197/501 - (39%)
Similarity:291/501 - (58%) Gaps:68/501 - (13%)


- Green bases have known domain annotations that are detailed below.


Human     6 MLVLIVLGIPSSATTGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGLKISQLVDVDE 70
            :|||:...:.|:        :|:|:.|:|.||:||.|.:|||.:....:.|.|||...||::|:|
  Fly    13 ILVLVAFSLVSA--------SEDEERLVRDLFRGYNKLIRPVQNMTQKVGVRFGLAFVQLINVNE 69

Human    71 KNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFENADGRFEGSLMTKVIV 135
            |||:|.:||||:..|.|::|:|:..|||||..:::|.:.:|.||||||.||||.:|....:.|::
  Fly    70 KNQIMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLI 134

Human   136 KSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTMVDLILINEN--VDRKDFFDN 198
            ...|.|:|.|||.|:||||:|||:||||:|.|.|||||||::|..|.|.|.|..  ||..|::.:
  Fly   135 YPTGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNFVDLSDYWKS 199

Human   199 GEWEILNAKGMKGNRRDGVYSYPF---ITYSFVLRRLPLFYTLFLIIPCLGLSFLTVLVFYLPSD 260
            |.|:|:...... |..:|..::|.   ||:..::||..||||:.||:|.:.:|||.|||||||::
  Fly   200 GTWDIIEVPAYL-NVYEGDSNHPTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLPAE 263

Human   261 EGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIVTVFVINVHHRSS 325
            .|||::|..|:|:||.||||::.:|:|.:|.|:|||.:||||..|..|:||:|||.:||.:.|..
  Fly   264 AGEKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINWNFRGP 328

Human   326 STYHPMAPWVKRLFLQKLPKLLCMK---------------------DHVDRYSSP-EKEESQPVV 368
            .| |.|..:::.:||..||..|.||                     .| ..|.|| |..:....:
  Fly   329 RT-HRMPMYIRSIFLHYLPAFLFMKRPRKTRLRWMMEMPGMSMPAHPH-PSYGSPAELPKHISAI 391

Human   369 KGK-----VLE---------KKKQKQLSDGEK----------------VLVAFLEKAADSIRYIS 403
            .||     |:|         |..:|..|.||.                :|.....||.:::.:|:
  Fly   392 GGKQSKMEVMELSDLHHPNCKINRKVNSGGELGLGDGCRRESESSDSILLSPEASKATEAVEFIA 456

Human   404 RHVKKEHFISQVVQDWKFVAQVLDRIFLWLFLIVSVTGSVLIFTPA 449
            .|::.|....|..:|||:||.|:||:.|::|.||:..|:|.|...|
  Fly   457 EHLRNEDLYIQTREDWKYVAMVIDRLQLYIFFIVTTAGTVGILMDA 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHRNB3NP_000740.1 Neur_chan_LBD 23..449 CDD:332142 192/482 (40%)
nAChRbeta1NP_523927.2 LIC 8..500 CDD:273305 196/497 (39%)
Neur_chan_LBD 28..236 CDD:280998 95/208 (46%)
Neur_chan_memb 243..498 CDD:280999 91/256 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D188416at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.