DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SLC2A13 and CG33282

DIOPT Version :9

Sequence 1:NP_443117.3 Gene:SLC2A13 / 114134 HGNCID:15956 Length:648 Species:Homo sapiens
Sequence 2:NP_001097067.1 Gene:CG33282 / 2768939 FlyBaseID:FBgn0053282 Length:460 Species:Drosophila melanogaster


Alignment Length:564 Identity:120/564 - (21%)
Similarity:198/564 - (35%) Gaps:153/564 - (27%)


- Green bases have known domain annotations that are detailed below.


Human    58 GGGVGDLERAARRQFQQDETPAFVYVVAVFSALGGFLFGYDTGVVSGAMLLLKRQLSLDALWQEL 122
            |.|||.|.....:....|....|...:|..|.||.                   .|.||:|...|
  Fly    32 GVGVGWLSPTLTKIQTADSPLDFEVNLAQISWLGS-------------------MLGLDSLCGNL 77

Human   123 LVSSTVGAAAVSALAGGALNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLVVGLGIGI 187
            .::..:..|              ||:..:.|.:..:.....::..|:|...|.|.|.:.|...|.
  Fly    78 TIAMLIERA--------------GRKFCLYLMAGPYACIWILIYCASNVYYLYAARFLCGFTGGA 128

Human   188 ASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKDGWRYMLGLAAVPAVIQ 252
            ..:.||::|:||:..|:||.|.::..|.:..|.....::.   :||   .:..:..||.:..|..
  Fly   129 GYLVVPIFISEVADSNIRGALTSMVMLSVDLGILAGYILS---TYL---AYHVVPFLAIILPVAY 187

Human   253 FFGFLFLPESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIEE-----EEKEVGSAGPV 312
            |...:.|||:..:|::|.|...|.......|..::...|..| |.|.||     ..::..:|.|:
  Fly   188 FIANIMLPETAPYLLKKSQLAAAENSFRYYRNQRSAICEQTS-KVNFEELRTAVLSQQTRNATPL 251

Human   313 ICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSATILQMSG-VEDDRLAIWLASVTAFTNFI 376
            ..:.|:..|..:.......|.:..|.||:.:.:.|.:.|.:.|| |.|...|..:..       :
  Fly   252 SYKDLTTKPALKGFAASIVLSLGYQFSGVFSFINYMSDIFKASGSVVDVNTATIIIG-------L 309

Human   377 FTLVGVW----LVEKVGRRKLTFGSLAGTTVALIILALGFVLSAQVSPRITFKPIAPSGQNATCT 437
            ..:|||:    ||:.||||.|...|..|..:..|  |.|                        |.
  Fly   310 VQIVGVYTSTILVDIVGRRVLMLISTMGVGIGCI--AFG------------------------CF 348

Human   438 RYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAWGRCENETKFKTEDIFWAYNFCP 502
            .|                   .:.:.|.|                                    
  Fly   349 TY-------------------LAKIYDLS------------------------------------ 358

Human   503 TPYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGINWIFNVLVSLTFLHTA 567
             .::|..|:.:|:.......|:..:.:.|..|::|:..||...:.|.       :.:||....|.
  Fly   359 -DFNWLPLVLMIIICYVANIGLIGIFFLVLVELFPVKIRSLATSLSV-------IFLSLLVFGTL 415

Human   568 E----YLTYYG-AFFLYAGFAAVGLLFIYG--CLPETKGKKLEE 604
            :    .|.|:| :|.::...|:..|.|.|.  .|.|||||.:.|
  Fly   416 KLFPLMLHYWGISFTMWFSAASALLTFFYFWLFLQETKGKSMIE 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SLC2A13NP_443117.3 Sugar_tr 84..609 CDD:278511 113/538 (21%)
MFS 86..591 CDD:119392 104/519 (20%)
CG33282NP_001097067.1 MFS 21..448 CDD:119392 113/551 (21%)
MFS_1 53..409 CDD:284993 96/491 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144079
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53651
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.