DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acadm and Arc42

DIOPT Version :9

Sequence 1:NP_031408.1 Gene:Acadm / 11364 MGIID:87867 Length:421 Species:Mus musculus
Sequence 2:NP_650840.1 Gene:Arc42 / 42364 FlyBaseID:FBgn0038742 Length:405 Species:Drosophila melanogaster


Alignment Length:381 Identity:149/381 - (39%)
Similarity:212/381 - (55%) Gaps:6/381 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse    41 LTEQQKEFQATARKFAREEIIPVAPEYDKSGEYPFPLIKRAWELGLINAHIPESCGGLGLGTFDA 105
            |:|..:..|.:.|.||..|:...|.::|:...||...|::..|||::...|||..||.||.....
  Fly    27 LSETHQMLQKSCRDFANNELSGNAAKFDREHLYPEKQIRQMGELGVMAVAIPEELGGTGLDYVAY 91

Mouse   106 CLITEELAYGC--TGVQTAIEANSLGQMPVILAGNDQQKKKYLGRMTEQPMMCAYCVTEPSAGSD 168
            .:..||::.||  .||..::. |||...|::..|||.|||.|:...|....:..:.::||..|||
  Fly    92 AIAMEEISRGCASAGVIMSVN-NSLYLGPLLSFGNDAQKKDYITPFTTGERVGCFALSEPGNGSD 155

Mouse   169 VAAIKTKAEKKGDEYVINGQKMWITNGGKANWYFLLARSNPDPKVPASKAFTGFIVEADTPGIHI 233
            ..|..|.|..|||.:|:||.|.||||..:|....:.|.:|...|   .|..:.|||...|.|..:
  Fly   156 AGAASTIATDKGDHFVLNGTKAWITNAFEAEAAIVFATTNKQLK---HKGISAFIVPKATKGFSL 217

Mouse   234 GKKELNMGQRCSDTRGIAFEDVRVPKENVLIGEGAGFKIAMGAFDRTRPTVAAGAVGLAQRALDE 298
            ||||..:|.|.|.|..:.|||..|||||:|...|.||||||...|..|..:|..|:|:.|.||:.
  Fly   218 GKKEDKLGIRGSSTCQLIFEDCVVPKENMLGEPGFGFKIAMQTLDAGRIGIAGQALGIGQAALEL 282

Mouse   299 ATKYALDRKTFGKLLVEHQGVSFLLAEMAMKVELARLSYQRAAWEVDSGRRNTYYASIAKAFAGD 363
            |..||..|:.|||.:.:.|.:...:|:|::.:|.|||...||||..|..:..|..|::||..|.:
  Fly   283 AVDYAQKRQAFGKPIAKLQSIQQKIADMSLAMESARLLTWRAAWLKDQKQPYTKEAAMAKLAASE 347

Mouse   364 IANQLATDAVQIFGGYGFNTEYPVEKLMRDAKIYQIYEGTAQIQRLIIAREHIEKY 419
            .|...:...:||.||.|:.|:...|:..|||:|.:|||||::||||:||...:::|
  Fly   348 AATLCSHQCIQILGGMGYVTDMAAERHYRDARITEIYEGTSEIQRLVIAGSILKEY 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcadmNP_031408.1 CaiA 39..420 CDD:224871 149/381 (39%)
MCAD 41..418 CDD:173846 148/378 (39%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P41367 278..281 1/2 (50%)
Arc42NP_650840.1 CaiA 27..405 CDD:224871 149/381 (39%)
SCAD_SBCAD 29..401 CDD:173847 147/375 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D589058at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101120
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.