DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF13 and IRC20

DIOPT Version :9

Sequence 1:NP_001365214.1 Gene:RNF13 / 11342 HGNCID:10057 Length:381 Species:Homo sapiens
Sequence 2:NP_013348.1 Gene:IRC20 / 850949 SGDID:S000004237 Length:1556 Species:Saccharomyces cerevisiae


Alignment Length:117 Identity:34/117 - (29%)
Similarity:49/117 - (41%) Gaps:31/117 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   240 CAICLDEYEDGDKLRILPCSHAYHCK-CVDPWLTKTKKTCPVCK--------------------Q 283
            |:|||.|.|.|   .|:.|.| |.|| |:..||....| ||:||                    :
Yeast  1239 CSICLGEVEIG---AIIKCGH-YFCKSCILTWLRAHSK-CPICKGFCSISEVYNFKFKNSTEKRE 1298

Human   284 KVV--PSQGDSDSDTDSSQEENEVTEHTPLLRPLASVSAQSFGALSESRSHQ 333
            |.:  |.:..:||..|:| .||.:..:...:..|.....:.|..::|  .||
Yeast  1299 KEIQEPRREGADSSQDNS-NENSIISNMSEVEKLFGNKYEQFHQINE--VHQ 1347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF13NP_001365214.1 PA_C_RZF_like 23..180 CDD:239038
RING-H2_RNF167 238..283 CDD:319711 21/63 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..381 12/51 (24%)
IRC20NP_013348.1 HepA 172..>568 CDD:223627
DEXQc_SHPRH 383..602 CDD:350828
RAD18 1234..>1327 CDD:227719 29/93 (31%)
RING-HC_RNF10 1239..1276 CDD:319450 19/41 (46%)
SF2_C_SNF 1356..1485 CDD:350180
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.