DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF13 and CG6923

DIOPT Version :10

Sequence 1:NP_009213.1 Gene:RNF13 / 11342 HGNCID:10057 Length:381 Species:Homo sapiens
Sequence 2:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster


Alignment Length:80 Identity:30/80 - (37%)
Similarity:46/80 - (57%) Gaps:12/80 - (15%)


- Green bases have known domain annotations that are detailed below.


Human   213 ARRNR---LRKDQLKKLPVHKFKK-------GDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCV 267
            :|.||   |...:...|| ||:::       .::.:.|||||:.:|..:::|.|||.|.:|..||
  Fly  1151 SRPNRGATLETIERNTLP-HKYRRVRRPSETDEDAEKCAICLNLFEIENEVRRLPCMHLFHTDCV 1214

Human   268 DPWLTKTKKTCPVCK 282
            |.||. |.|.||:|:
  Fly  1215 DQWLV-TNKHCPICR 1228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF13NP_009213.1 PA_C_RZF_like 23..180 CDD:239038
RING-H2_RNF13 230..288 CDD:438450 23/60 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..381
CG6923NP_001262484.1 HRD1 <1155..>1256 CDD:227568 28/76 (37%)
RING-H2_RNF111-like 1185..1230 CDD:438137 22/45 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.