DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF13 and C18B12.4

DIOPT Version :9

Sequence 1:NP_001365214.1 Gene:RNF13 / 11342 HGNCID:10057 Length:381 Species:Homo sapiens
Sequence 2:NP_510498.1 Gene:C18B12.4 / 181600 WormBaseID:WBGene00007666 Length:456 Species:Caenorhabditis elegans


Alignment Length:366 Identity:98/366 - (26%)
Similarity:160/366 - (43%) Gaps:64/366 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    69 INSKPENACEPIVPPPVKDNSSGTFIVLIRRLD----CNFDIKVLNAQRAGY--KAAIVHNVDSD 127
            :..:|.:||.|:................:.|.:    |.|..:....|.:.|  :..|.:|....
 Worm    71 VGVEPVDACGPVRIAQNHTTRCHNLFAFVSRSNISHPCKFSHQAFMVQNSTYPFRLVIFYNYPGQ 135

Human   128 DLISMGSNDIEVLKKIDIPSVFIGESSANSLKDEFTYEKGGHL-ILVPEFSLPLEYYLIPFLIIV 191
            :.|||  ...|:..|::||.:.|..:....:..:|:...|..| :.:......|..||||||:::
 Worm   136 EPISM--EGTELRDKVNIPVLMISHACKEEIAKKFSDTAGYRLRVRIDPGYYELFRYLIPFLVVI 198

Human   192 GICLILIVIFMITKFVQDRHRARRNRLRKDQLKKLPVHKFKKGDEYDVCAICLDEYEDGDKLRIL 256
            ..|..|.:|.:..:...:|.:..:.||.|..|||:||.|::.||:.|.|||||:.:..|:|||.|
 Worm   199 VFCFALFLITLCVRGCVERRKLNKRRLSKRNLKKIPVKKYRLGDDPDTCAICLESFASGEKLRHL 263

Human   257 PCSHAYHCKCVDPWLTKTKKTCPVCKQKV--------------VPSQGDSDS------------- 294
            ||.|.:||.|:|.|||:|:|.||:||:|:              ..|||.:|:             
 Worm   264 PCRHVFHCNCIDVWLTQTRKICPLCKRKIGTDSDSECSTNDLASTSQGPNDATALYNNADNQSGF 328

Human   295 ----------DTDSSQE---ENEVTEHTPLLRPLASVSAQSFGALSESRSHQNMTESSDYEEDD- 345
                      |..||||   :.::..|....|.:......:|..|..|..|:::...|..|... 
 Worm   329 ELPVPQGQMVDLWSSQEALVDQDIVLHNTTRRSITGFVRNAFRKLRNSPRHRDVDVHSGLEGGSY 393

Human   346 --NEDTDSSD----AENEINEHDVVVQLQPNGERDYNIANT 380
              .:.|.|:|    .|||:::        |....:.||.::
 Worm   394 LVRQQTTSNDNDHLLENEVSD--------PTSSSELNIPSS 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF13NP_001365214.1 PA_C_RZF_like 23..180 CDD:239038 22/117 (19%)
RING-H2_RNF167 238..283 CDD:319711 26/44 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..381 26/143 (18%)
C18B12.4NP_510498.1 PA <74..176 CDD:333703 21/103 (20%)
HRD1 <223..>335 CDD:227568 43/111 (39%)
RING-H2_RNF103 246..291 CDD:319387 26/44 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I6450
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I3469
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001489
OrthoInspector 1 1.000 - - otm15079
orthoMCL 1 0.900 - - OOG6_103040
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1776
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.750

Return to query results.
Submit another query.