DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABARAP and Atg8b

DIOPT Version :10

Sequence 1:NP_009209.1 Gene:GABARAP / 11337 HGNCID:4067 Length:117 Species:Homo sapiens
Sequence 2:NP_650649.1 Gene:Atg8b / 42132 FlyBaseID:FBgn0038539 Length:120 Species:Drosophila melanogaster


Alignment Length:116 Identity:90/116 - (77%)
Similarity:107/116 - (92%) Gaps:0/116 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIR 65
            |.:.||::|.|:|||:||:|||:|||||||||||||||.|..:|||||||||:||||||||||||
  Fly     3 MNYQYKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKKYLVPADLTVGQFYFLIR 67

Human    66 KRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG 116
            |||:||.:|||||||||||||||||||.|||||.::|:||||:|:||:|||
  Fly    68 KRINLRPDDALFFFVNNVIPPTSATMGALYQEHFDKDYFLYISYTDENVYG 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABARAPNP_009209.1 Interaction with beta-tubulin. /evidence=ECO:0000269|PubMed:9892355 1..22 11/20 (55%)
Ubl_ATG8_GABARAP 2..116 CDD:340752 87/113 (77%)
Interaction with GPHN. /evidence=ECO:0000250|UniProtKB:Q9DCD6 36..117 65/81 (80%)
Interaction with GABRG2. /evidence=ECO:0000269|PubMed:9892355 36..68 26/31 (84%)
Interaction with LIR (LC3 nteracting Region) motif of ATG3. /evidence=ECO:0000269|PubMed:37252361, ECO:0007744|PDB:8AFI 48..50 1/1 (100%)
Atg8bNP_650649.1 Ubl_ATG8_GABARAP_like 7..113 CDD:340544 84/105 (80%)

Return to query results.
Submit another query.