DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GABARAP and Atg8a

DIOPT Version :10

Sequence 1:NP_009209.1 Gene:GABARAP / 11337 HGNCID:4067 Length:117 Species:Homo sapiens
Sequence 2:NP_727447.1 Gene:Atg8a / 32001 FlyBaseID:FBgn0052672 Length:121 Species:Drosophila melanogaster


Alignment Length:117 Identity:107/117 - (91%)
Similarity:113/117 - (96%) Gaps:0/117 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIR 65
            |||.|||||.|||||:||:|||:||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MKFQYKEEHAFEKRRAEGDKIRRKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIR 65

Human    66 KRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL 117
            ||||||.||||||||||||||||||||.|||||||||:|||||||||:|||:
  Fly    66 KRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHEEDYFLYIAYSDENVYGM 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GABARAPNP_009209.1 Interaction with beta-tubulin. /evidence=ECO:0000269|PubMed:9892355 1..22 16/20 (80%)
Ubl_ATG8_GABARAP 2..116 CDD:340752 104/113 (92%)
Interaction with GPHN. /evidence=ECO:0000250|UniProtKB:Q9DCD6 36..117 76/80 (95%)
Interaction with GABRG2. /evidence=ECO:0000269|PubMed:9892355 36..68 31/31 (100%)
Interaction with LIR (LC3 nteracting Region) motif of ATG3. /evidence=ECO:0000269|PubMed:37252361, ECO:0007744|PDB:8AFI 48..50 1/1 (100%)
Atg8aNP_727447.1 Ubl_ATG8_GABARAP 2..116 CDD:340752 104/113 (92%)

Return to query results.
Submit another query.