DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CBX3 and Pc

DIOPT Version :10

Sequence 1:NP_009207.2 Gene:CBX3 / 11335 HGNCID:1553 Length:183 Species:Homo sapiens
Sequence 2:NP_524199.1 Gene:Pc / 40358 FlyBaseID:FBgn0003042 Length:390 Species:Drosophila melanogaster


Alignment Length:127 Identity:36/127 - (28%)
Similarity:56/127 - (44%) Gaps:28/127 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    10 KMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIE 74
            |..|.:.|:....::.....:..||::.:||..|.|||.:||||:....||||||.|:....||:
  Fly     6 KGSKGKLGRDNATDDPVDLVYAAEKIIQKRVKKGVVEYRVKWKGWNQRYNTWEPEVNILDRRLID 70

Human    75 AFLNSQKAG--KEKDGTKRKSLS-----DSESD---------------------DSKSKKKR 108
            .:..:.|:.  ..|.|.|:|...     :||.|                     |.:|||::
  Fly    71 IYEQTNKSSGTPSKRGIKKKEKEPDPEPESEEDEYTFTENDVDTHQATTSSATHDKESKKEK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CBX3NP_009207.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 3/17 (18%)
CD_HP1gamma_Cbx3 29..78 CDD:349299 21/48 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..125 12/58 (21%)
CSD_HP1gamma_Cbx3 116..173 CDD:349303
PcNP_524199.1 CD_polycomb 23..76 CDD:349291 21/52 (40%)
CBX7_C 341..373 CDD:465385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.