DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CBX3 and Su(var)205

DIOPT Version :9

Sequence 1:NP_009207.2 Gene:CBX3 / 11335 HGNCID:1553 Length:183 Species:Homo sapiens
Sequence 2:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster


Alignment Length:206 Identity:88/206 - (42%)
Similarity:123/206 - (59%) Gaps:36/206 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    11 MGKKQNG--KSKKVEEA--EPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPE 71
            ||||.:.  .|.||.:|  |.||:.|||::||||..|||||:|||||:.:.:||||||.||||.:
  Fly     1 MGKKIDNPESSAKVSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQD 65

Human    72 LIEAFLNSQK-----AGKEKD---------------------GTKRKSLSDSESDDSKSKKKRDA 110
            ||:.:..|:|     |..:||                     .:||||...:....:|||:..||
  Fly    66 LIQQYEASRKDEEKSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDA 130

Human   111 ------ADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYE 169
                  .....||.|||:.|:|:||:|::|.|.||:::|..|:|::|.:..||.|.|::||.|||
  Fly   131 EQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFYE 195

Human   170 ERLTWHSCPED 180
            |||:|:|..||
  Fly   196 ERLSWYSDNED 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CBX3NP_009207.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 9/20 (45%)
CD_HP1gamma_Cbx3 29..78 CDD:349299 30/48 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..125 19/77 (25%)
CSD_HP1gamma_Cbx3 116..173 CDD:349303 29/56 (52%)
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 29/47 (62%)
ChSh 141..202 CDD:197638 31/60 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.