DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHB2 and CG14736

DIOPT Version :10

Sequence 1:NP_001138303.1 Gene:PHB2 / 11331 HGNCID:30306 Length:299 Species:Homo sapiens
Sequence 2:NP_731666.2 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster


Alignment Length:231 Identity:53/231 - (22%)
Similarity:105/231 - (45%) Gaps:46/231 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    54 RIGGVQQDTILAEGLHFRIPWFQYPIIYDIR-----ARPRKISSPTGSKDLQMVNISLRV---LS 110
            |:|.:::. :...||.|.:|........|:|     .||:.:.    :||...:.::..|   :.
  Fly    93 RLGRLRKG-LRGPGLVFILPCIDETHRVDMRTDVTNVRPQDVL----TKDSVTITVNAVVYYCIY 152

Human   111 RPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDF 175
            .|    :.|:.|   :|..::....|....|:::|.....:.|:|.|.|:|..|::.:......:
  Fly   153 SP----IDSIIQ---VDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSREIQQAVAGITYRW 210

Human   176 SLILDDVAITELSF--SREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKML 238
            .:.::.|.:.:::.  |.|.:.|.||:.|                :|.|.||:.||||.:|:|.|
  Fly   211 GVRVERVDVMDITLPTSLERSLASEAEAV----------------REARAKIILAEGELKASKAL 259

Human   239 GEA---LSKNPGYIKLRKIRAAQNISKTIATSQNRI 271
            .||   :|:|...::||.::...:|:     |:.|:
  Fly   260 KEASDVMSENKITLQLRHLQILSSIA-----SERRV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHB2NP_001138303.1 Necessary for transcriptional repression. /evidence=ECO:0000269|PubMed:10359819 19..49
SPFH_prohibitin 40..235 CDD:259799 41/190 (22%)
LC3-interaction region. /evidence=ECO:0000269|PubMed:28017329 121..124 1/2 (50%)
Necessary for transcriptional repression. /evidence=ECO:0000269|PubMed:10359819 150..174 6/23 (26%)
CG14736NP_731666.2 SPFH_like 100..305 CDD:473137 51/224 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.