DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CTRC and CG12256

DIOPT Version :9

Sequence 1:XP_011538852.1 Gene:CTRC / 11330 HGNCID:2523 Length:280 Species:Homo sapiens
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:201 Identity:60/201 - (29%)
Similarity:96/201 - (47%) Gaps:34/201 - (16%)


- Green bases have known domain annotations that are detailed below.


Human     1 MLGITVLAALLACA--SSCGVPSFPP---------------NLSARVVGGEDARPHSW-PWQISL 47
            |.|:|....||:..  :..||.|.|.               |...|||||.|.....: |:|:|:
  Fly     1 MNGVTYFVLLLSSTLLALGGVQSKPMGNVIDLDKYFEEADLNSQERVVGGYDVPEDEYVPYQVSM 65

Human    48 QYL-KNDTWRHTCGGTLIASNFVLTAAHCISNTRTYRVAVGKNNLEVEDEEGSLFVGVDTIHVHK 111
            |:| ::...||.|||:|||.|.|||||||::.....|::|.....::.|..| ....|.:..:::
  Fly    66 QFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNASRISVVAGIRDLNDSSG-FRSQVQSYEMNE 129

Human   112 RWNALLLRNDIALIKLAEHVELSD----TIQVACLPEKDSLLPKDYPCYVTGWGRLWR-----GL 167
            .:.. |:.:|||::|:....||.:    ||.|:    ...::..|....:||||.::.     ..
  Fly   130 NYQE-LVTSDIAILKIDPPFELDEKRVSTIDVS----GSDMVGADQEVLLTGWGSVFHFGTGPFA 189

Human   168 RWPTEL 173
            ::||.|
  Fly   190 KYPTVL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CTRCXP_011538852.1 Tryp_SPc 29..>163 CDD:214473 47/139 (34%)
Tryp_SPc 30..>173 CDD:238113 48/153 (31%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 50/156 (32%)
Tryp_SPc 47..280 CDD:238113 49/155 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5242
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.