DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FKBP9 and Fkbp14

DIOPT Version :9

Sequence 1:NP_001271270.1 Gene:FKBP9 / 11328 HGNCID:3725 Length:623 Species:Homo sapiens
Sequence 2:NP_001246448.1 Gene:Fkbp14 / 37449 FlyBaseID:FBgn0010470 Length:220 Species:Drosophila melanogaster


Alignment Length:355 Identity:87/355 - (24%)
Similarity:137/355 - (38%) Gaps:162/355 - (45%)


- Green bases have known domain annotations that are detailed below.


Human   294 QASLVFDVALLDLHNPKDSISIENKVV------------PENCERISQSGDFLRYHYNGTL-LDG 345
            :::||....||        ::|.|.:|            ||.||:.|::||.|..||.||| .||
  Fly     3 KSNLVISCLLL--------VAISNSLVRAQDLKVEVISTPEVCEQKSKNGDSLTMHYTGTLQADG 59

Human   346 TLFDSSYSRNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSAVLVF 410
            ..||||:.|::.|...:|.|.||.|.|:|||.:|:||||::.:||.||||::|.||         
  Fly    60 KKFDSSFDRDQPFTFQLGAGQVIKGWDQGLLNMCVGEKRKLTIPPQLGYGDQGAGN--------- 115

Human   411 DIHVIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKTYNIVLGS 475
                                                                             
  Fly   116 ----------------------------------------------------------------- 115

Human   476 GQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELVAGLPEGYMFI 540
                                  :|||               .|.|:||:||:.           |
  Fly   116 ----------------------VIPP---------------KATLLFDVELIN-----------I 132

Human   541 WNGEVSPNLFEEIDKDGNGEVLLEE----FSEYIHAQVASGKGK--------LAPGFDAELIVKN 593
            .|...:.|:|:|||.:.:.::..||    .|||:..|:.:.:|:        ||   :.:.:|:.
  Fly   133 GNAPPTTNVFKEIDDNADKQLSREEVIVYVSEYLKKQMTAVEGQDSEELKNMLA---ENDKLVEE 194

Human   594 MFTNQDRNGDGKVTAEEFKLKDQEAKHDEL 623
            :|.::|::.:|.::.:||    ...|||||
  Fly   195 IFQHEDKDKNGFISHDEF----SGPKHDEL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FKBP9NP_001271270.1 FKBP_C 47..191 CDD:278674
FKBP_C 212..304 CDD:278674 2/9 (22%)
FKBP_C 324..415 CDD:278674 42/91 (46%)
FKBP_C 435..527 CDD:278674 8/91 (9%)
EF-hand_7 548..612 CDD:290234 19/75 (25%)
EFh 550..611 CDD:238008 17/72 (24%)
Fkbp14NP_001246448.1 FKBP_C 37..130 CDD:278674 50/203 (25%)
EF-hand_7 140..212 CDD:290234 18/74 (24%)
EFh 141..212 CDD:298682 17/73 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1507309at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.