DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PARK7 and DJ-1alpha

DIOPT Version :9

Sequence 1:NP_001116849.1 Gene:PARK7 / 11315 HGNCID:16369 Length:189 Species:Homo sapiens
Sequence 2:NP_610916.1 Gene:DJ-1alpha / 36543 FlyBaseID:FBgn0033885 Length:217 Species:Drosophila melanogaster


Alignment Length:185 Identity:104/185 - (56%)
Similarity:129/185 - (69%) Gaps:4/185 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     3 SKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPY 67
            :|.||:|||.||||||..|..||:||..|.||||||...:||:|||.|||.||.|||:|...|.|
  Fly    30 AKNALIILAPGAEEMEFTISADVLRRGKILVTVAGLHDCEPVKCSRSVVIVPDTSLEEAVTRGDY 94

Human    68 DVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDK 132
            ||||||||..|.:.|..|:||.::|:.||::.||||||||.||||..|.||.|..:|:||..|.:
  Fly    95 DVVVLPGGLAGNKALMNSSAVGDVLRCQESKGGLIAAICAAPTALAKHGIGKGKSITSHPDMKPQ 159

Human   133 MMNGGHYTYSENR-VEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQV-KAPL 185
            :..  .|.|.::: |.:||.|:|||||||:|:|||.|.|.|.|.|||.:| ||.|
  Fly   160 LKE--LYCYIDDKTVVQDGNIITSRGPGTTFDFALKITEQLVGAEVAKEVAKAML 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PARK7NP_001116849.1 not_thiJ 5..184 CDD:213612 101/180 (56%)
DJ-1alphaNP_610916.1 ThiJ 33..210 CDD:333423 100/178 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147888
Domainoid 1 1.000 171 1.000 Domainoid score I3745
eggNOG 1 0.900 - - E1_COG0693
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38295
Inparanoid 1 1.050 181 1.000 Inparanoid score I3996
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54253
OrthoDB 1 1.010 - - D1165707at2759
OrthoFinder 1 1.000 - - FOG0002774
OrthoInspector 1 1.000 - - otm42153
orthoMCL 1 0.900 - - OOG6_101257
Panther 1 1.100 - - O PTHR48094
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1763
SonicParanoid 1 1.000 - - X2164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.