DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment PHF21B and Mi-2

DIOPT Version :9

Sequence 1:	NP_612424.1	Gene:	PHF21B / 112885	HGNCID:	25161	Length:	531	Species:	Homo sapiens
Sequence 2:	NP_001014591.1	Gene:	Mi-2 / 40170	FlyBaseID:	FBgn0262519	Length:	1983	Species:	Drosophila melanogaster

Alignment Length:	61	Identity:	29/61 - (47%)
Similarity:	33/61 - (54%)	Gaps:	2/61 - (3%)

- Green bases have known domain annotations that are detailed below.

Human   351 HDEHCAACKRGANLQPCGTCPGAYHLSCLEPPLKTAPKGVWVCPRCQQKAL--KKDEGVPW 409
            |.|.|..||.|..|..|.:||.|||..||.|||.|.|.|.|.||||....|  |.::.:.|
  Fly   437 HQEFCRVCKDGGELLCCDSCPSAYHTFCLNPPLDTIPDGDWRCPRCSCPPLTGKAEKIITW 497

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
PHF21B	NP_612424.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	79..99
		Nuc_recep-AF1	108..193	CDD:288658
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	184..222
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	238..277
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	295..314
		PHD_PHF21B	354..396	CDD:276999	22/41 (54%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	507..531
Mi-2	NP_001014591.1	CHDNT	138..190	CDD:285335
		PHD1_CHD_II	380..422	CDD:277006
		PHD2_CHD_II	440..482	CDD:277007	22/41 (54%)
		CHROMO	490..558	CDD:237991	2/8 (25%)
		CHROMO	615..667	CDD:214605
		SNF2_N	734..1028	CDD:278600
		DEXDc	751..907	CDD:238005
		Helicase_C	1053..1167	CDD:278689
		DUF1087	<1292..1337	CDD:283996
		DUF1086	1380..1517	CDD:283992
		CHDCT2	1756..1927	CDD:285336
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0383
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900