DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHF21B and Chd3

DIOPT Version :9

Sequence 1:NP_612424.1 Gene:PHF21B / 112885 HGNCID:25161 Length:531 Species:Homo sapiens
Sequence 2:NP_649111.1 Gene:Chd3 / 40111 FlyBaseID:FBgn0023395 Length:892 Species:Drosophila melanogaster


Alignment Length:168 Identity:47/168 - (27%)
Similarity:68/168 - (40%) Gaps:60/168 - (35%)


- Green bases have known domain annotations that are detailed below.


Human   335 LTARANEDPCW-----------------KNEITHDEHCAACKRGANLQPCGTCPGAYHLSCLEPP 382
            ::::...||.|                 |.:...:|:|..|..|.:|..|.:||..||.:||.||
  Fly     1 MSSKRGADPDWKTPGKASKDKRPKTNAKKQKFRDEEYCKVCSDGGDLLCCDSCPSVYHRTCLSPP 65

Human   383 LKTAPKGVWVCPRC------QQKAL-------------------KKDEGVPWTGMLAIVHSYVTH 422
            ||:.|||.|:||||      .:|.|                   :::..:.|.||     ||...
  Fly    66 LKSIPKGDWICPRCIPLPGKAEKILSWRWALDRSVELRTSKGEKRREYFIKWHGM-----SYWHC 125

Human   423 KTVKEEEKQKLL---------QRGSELQNEHQQLEERD 451
            :.:  .|.|.||         ||.|::  |...|||.|
  Fly   126 EWI--PEGQMLLHHASMVASFQRRSDM--EEPSLEELD 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHF21BNP_612424.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..99
Nuc_recep-AF1 108..193 CDD:288658
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 184..222
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..277
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 295..314
PHD_PHF21B 354..396 CDD:276999 21/41 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 507..531
Chd3NP_649111.1 PHD2_CHD_II 37..79 CDD:277007 21/41 (51%)
CHROMO 85..147 CDD:237991 12/68 (18%)
CHROMO 181..233 CDD:214605
SNF2_N 270..561 CDD:278600
DEXDc 288..440 CDD:238005
Helicase_C 585..700 CDD:278689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0383
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.