DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F8 and Cyp4c3

DIOPT Version :9

Sequence 1:NP_009184.1 Gene:CYP4F8 / 11283 HGNCID:2648 Length:520 Species:Homo sapiens
Sequence 2:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster


Alignment Length:445 Identity:166/445 - (37%)
Similarity:250/445 - (56%) Gaps:29/445 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    91 WLGPITPIINLCHPDIVRSVINTSDAITDKDIVFYKTLKPWLGDGLLLSVGDKWRHHRRLLTPAF 155
            |.| ..|.:.|..|:.|..::|:...:....  .|..|.||||:|||.|...||...|::|||||
  Fly   101 WQG-TAPRVLLFEPETVEPILNSQKFVNKSH--DYDYLHPWLGEGLLTSTDRKWHSRRKILTPAF 162

Human   156 HFNILKPYIKIFSKSANIMHAKWQRLAME-GSTCLDVFEHISLMTLD-----SLQKCIFSFDSNC 214
            ||.||..:|.:|::.:.::..|   ||:| ||...::|.:::|.|||     ::.:.|:: .||.
  Fly   163 HFKILDDFIDVFNEQSAVLARK---LAVEVGSEAFNLFPYVTLCTLDIVCETAMGRRIYA-QSNS 223

Human   215 QEKPSEYITAIMELSALVVKRNNQFFRYKDFLYFLTPCGRRFHRACRLVHDFTDAVIQERRRTL- 278
            :   |||:.|:..:.::|..|..:.:...||::.||...:........:|.|::.||:||:..| 
  Fly   224 E---SEYVKAVYGIGSIVQSRQAKIWLQSDFIFSLTAEYKLHQSYINTLHGFSNMVIRERKAELA 285

Human   279 --------TSQGVDDFLQAKAKSKTLDFIDVLLLSEDKNGKELSDEDIRAEADTFMFGGHDTTAS 335
                    .:....|......|.|.|.|:| ||:...|.|..||:||||.|.|||||.|||||::
  Fly   286 ILQENNNNNNNNAPDAYDDVGKKKRLAFLD-LLIDASKEGTVLSNEDIREEVDTFMFEGHDTTSA 349

Human   336 GLSWVLYNLARHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCLKESLRLHPPIPTFAR 400
            .:||.|:.|..|||||||..:|:..:..|.:.......:|..:.:|..|:|:||||.|.:|..||
  Fly   350 AISWTLFLLGCHPEYQERVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMAR 414

Human   401 GCTQDVVLPDSRVIPKGNVCNINIFAIHHNPSVWPDPEVYDPFRFDPENAQKRSPMAFIPFSAGP 465
            ...:||.: ..:::|.|....|..:|:|.||.|:|.||.::|..|.|||...|.|.|:|||||||
  Fly   415 MVGEDVNI-GGKIVPAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGP 478

Human   466 RNCIGQKFAMAEMKVVLALTLLRFRI-LPDHREP-RRTPEIVLRAEDGLWLRVEP 518
            |||||||||:.|.|.|::..|.:::| ..|.||. ....|::||.:|||.:::.|
  Fly   479 RNCIGQKFAILEEKAVISTVLRKYKIEAVDRREDLTLLGELILRPKDGLRVKITP 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F8NP_009184.1 p450 52..504 CDD:306555 159/429 (37%)
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 165/441 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154671
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.