DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F8 and Cyp4d8

DIOPT Version :9

Sequence 1:NP_009184.1 Gene:CYP4F8 / 11283 HGNCID:2648 Length:520 Species:Homo sapiens
Sequence 2:NP_523961.2 Gene:Cyp4d8 / 38841 FlyBaseID:FBgn0015033 Length:505 Species:Drosophila melanogaster


Alignment Length:547 Identity:171/547 - (31%)
Similarity:266/547 - (48%) Gaps:107/547 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    20 LLLLVVGASWLLARILAWTYAFYHNG-----RRLRCFPQPRKQNWFLGHLGLVTPTEEGLRVLTQ 79
            |::|:.||.|::           |.|     |::...|.|           :..|....::::.:
  Fly     6 LVVLLFGAGWII-----------HLGQADRRRKVANLPGP-----------ICPPLIGAMQLMLR 48

Human    80 LVATYPQGFVR---------------WLGPITPIINLCHPDIVRSVINTSDAITDKDIV------ 123
            |   .|:.|::               |      |.|       |.:|.:.||..::.::      
  Fly    49 L---NPKTFIKVGREYVLKFGHLQRVW------IFN-------RLLIMSGDAELNEQLLSSQEHL 97

Human   124 ----FYKTLKPWLGDGLLLSVGDKWRHHRRLLTPAFHFNILKPYIKIFSKSANIMHAKWQRLAME 184
                .||.|..|||:|||||.|..|...|:::||.|||:||:.::::|.:.:||.   .||||.:
  Fly    98 VKHPVYKVLGQWLGNGLLLSDGKVWHQRRKIITPTFHFSILEQFVEVFDQQSNIC---VQRLAQK 159

Human   185 --GSTCLDVFEHISLMTLDSLQKCIFSFDSNCQEKPS-EYITAIMELSALVVKRNNQFFRYKDFL 246
              |:| .||:..|....||.:.:.........|...| .|..|:.|.:||:..|....:...:.|
  Fly   160 ANGNT-FDVYRSICAAALDIIAETAMGTKIYAQANESTPYAEAVNECTALLSWRFMSVYLQVELL 223

Human   247 YFLTPCGRRFHRA--CRLVHDFTDAVIQERRRTLTSQGVDDFLQAKAKSKTLD------------ 297
            :.||....::.:.  .|.:.:||..||::||:.|..|          :||.:|            
  Fly   224 FTLTHPHLKWRQTQLIRTMQEFTIKVIEKRRQALEDQ----------QSKLMDTADEDVGSKRRM 278

Human   298 -FIDVLLLSEDKNGKELSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQEL 361
             .:||||:| ..:|:.|::::||.|.|||||.|||||.|.||:.|:.|:||||.|.:..:|:.::
  Fly   279 ALLDVLLMS-TVDGRPLTNDEIREEVDTFMFEGHDTTTSALSFCLHELSRHPEVQAKMLEEIVQV 342

Human   362 LKDREPKEIEWDDLAQLPFLTMCLKESLRLHPPIPTFARGCTQDVVLPDS----RVIPKGNVCNI 422
            |.....:.:...||.:|.::...:|||||::||:|...|....|.....|    .|||.|:...|
  Fly   343 LGTDRSRPVSIRDLGELKYMECVIKESLRMYPPVPIVGRKLQTDFKYTHSVHGDGVIPAGSEIII 407

Human   423 NIFAIHHNPSVWPDPEVYDPFRFDPENAQKRSPMAFIPFSAGPRNCIGQKFAMAEMKVVLALTLL 487
            .||.:|..|..:|:|:.:.|.|.  ||..:.:|...||||||||||||||||..|||::||..:.
  Fly   408 GIFGVHRQPETFPNPDEFIPERH--ENGSRVAPFKMIPFSAGPRNCIGQKFAQLEMKMMLAKIVR 470

Human   488 RFRILPDHREPRRTPEIVLRAEDGLWL 514
            .:.:||..:.......||||:|.|..|
  Fly   471 EYELLPMGQRVECIVNIVLRSETGFQL 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F8NP_009184.1 p450 52..504 CDD:306555 156/498 (31%)
Cyp4d8NP_523961.2 CYP4 66..497 CDD:410721 156/460 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154726
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.