DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F8 and Cyp4p2

DIOPT Version :9

Sequence 1:NP_009184.1 Gene:CYP4F8 / 11283 HGNCID:2648 Length:520 Species:Homo sapiens
Sequence 2:NP_610472.1 Gene:Cyp4p2 / 35946 FlyBaseID:FBgn0033395 Length:520 Species:Drosophila melanogaster


Alignment Length:503 Identity:150/503 - (29%)
Similarity:238/503 - (47%) Gaps:58/503 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    29 WLLARILA---WTY---------AFYHNGRRLR---------CFPQPRKQNWFLGHLGLV-TPTE 71
            |:...||.   |.|         ||:  .||::         ..|..:.:..|.....|: ..|:
  Fly     7 WISVAILVVIHWIYKVNKDYNILAFF--ARRVQTKDGKPLDSLVPMIKGRTVFANCFDLLGKDTD 69

Human    72 EGLRVLTQLVAT-------YPQGFVRWLGPITPIINLCHPDIVRSVINTSDAITDKDIVFYKTLK 129
            :....|.||...       |..||..:        |:.......:::|..:.||..  |.|..|.
  Fly    70 QVFTHLRQLAKNSGDSYLQYSMGFSNF--------NVIDAHNAANILNHPNLITKG--VIYNFLH 124

Human   130 PWLGDGLLLSVGDKWRHHRRLLTPAFHFNILKPYIKIFSKSANIMHAKWQRLAMEGSTCLDVFEH 194
            |:|..|:|.:...||...|.:||..||.:||..:.:||...:....:::|.   :....:.:.:.
  Fly   125 PFLRTGVLTATEKKWHTRRSMLTRTFHLDILNQFQEIFIAESLKFVSQFQG---QNEVVVSLKDR 186

Human   195 ISLMTLDSLQKCIFSFD-SNCQEKPSEYITAIMELSALVVKRNNQFFRYKDFLYFLTPCGRRFHR 258
            ||..||:|:.:...... ....||...|......:...:.:|......:.|.:|.:. .|.:::.
  Fly   187 ISRFTLNSICETAMGIKLDEMAEKGDRYRANFHIIDEGLTRRIVNPLYWDDCVYNMF-TGHKYNA 250

Human   259 ACRLVHDFTDAVIQERRRTL--------TSQGVDDFLQAKAKSKTLDFIDVLLLSEDKNGKELSD 315
            |.::||:|:..:|.:||..|        .:|..||.: ...:.|....:|.|:.:| |:|. :.|
  Fly   251 ALKVVHEFSREIIAKRRVLLEEELENRRATQTADDDI-CVIRKKRFAMLDTLICAE-KDGL-IDD 312

Human   316 EDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPF 380
            ..|..|.||.|..|:|||:.||.:.|.|::.:...||.|.||:||.:.| :...:....|::|.:
  Fly   313 IGISEEVDTLMAEGYDTTSIGLVFGLMNMSLYAAEQELCYQEIQEHILD-DLSNLNLSQLSKLNY 376

Human   381 LTMCLKESLRLHPPIPTFARGCTQDVVLPDSRVIPKGNVCNINIFAIHHNPSVWPDPEVYDPFRF 445
            |...:||::||:|.||...|...|:..|.:..::||.:..||::|.||.||..|..||.:.|.||
  Fly   377 LGYFIKETMRLYPSIPIMGRQTLQETELENGLILPKRSQINIHVFDIHRNPKYWESPEEFRPERF 441

Human   446 DPENAQKRSPMAFIPFSAGPRNCIGQKFAMAEMKVVLALTLLRFRILP 493
            .|:|..||.|.|:||||||.|||||||:||.|||.::.:.|..|:|||
  Fly   442 LPQNCLKRHPYAYIPFSAGQRNCIGQKYAMQEMKTLMVVILKHFKILP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F8NP_009184.1 p450 52..504 CDD:306555 141/459 (31%)
Cyp4p2NP_610472.1 p450 63..514 CDD:299894 139/445 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154846
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.