DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F8 and Cyp9b2

DIOPT Version :9

Sequence 1:NP_009184.1 Gene:CYP4F8 / 11283 HGNCID:2648 Length:520 Species:Homo sapiens
Sequence 2:NP_523646.1 Gene:Cyp9b2 / 35635 FlyBaseID:FBgn0015039 Length:505 Species:Drosophila melanogaster


Alignment Length:540 Identity:126/540 - (23%)
Similarity:221/540 - (40%) Gaps:85/540 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    20 LLLLVVGASWLLARILAWTYAFYHNGRRLRCF---PQPRKQNWFLGHLGLVTPTEEGL-RVLTQL 80
            |.|:|:|  :|   |..|:.|.:......:.:   |.|     |:|::......:... |.||:.
  Fly     8 LALVVIG--YL---IYKWSTATFKTFEERKLYFEKPYP-----FVGNMAAAALQKSSFQRQLTEF 62

Human    81 V-ATYPQGFVRWLGPITPIINLCHPDIVRSVI--------NTSDAITDKDIVFYKTLKPWLGDGL 136
            . .|.....|.:....||:|.|..|::::.|.        |....||..|.:|        .|.|
  Fly    63 YERTRQHKLVGFFNMRTPMITLNDPELIKKVCVKDFDHFPNHQPFITSNDRLF--------NDML 119

Human   137 LLSVGDKWRHHRRLLTPAFHFNILKPYIKIFSKS--ANIMHAKWQRLAMEGSTCLDVFEHI--SL 197
            .:....:|:|.|..|||.|....::....:.::|  ..:.|.......:.|....:|...:  :.
  Fly   120 SVMRDQRWKHMRNTLTPVFTAAKMRNMFTLMNESFAECLQHLDSSSKTLPGRKGFEVDMKVMCNK 184

Human   198 MTLDSLQKCIFSFDSNCQEKPSEYITAIMELSALVVKRNNQFFRYKDFLYFLTPCGRRFHRACRL 262
            ::.|.:....|....|..:.|......|.:  :||..|..|||::  .|..|.|  :.|......
  Fly   185 LSNDIIATTAFGLKVNSYDNPKNEFYEIGQ--SLVFSRGLQFFKF--MLSTLVP--KLFSLLKLT 243

Human   263 VHDFTDAVIQERRRTLTSQGVDDF-------LQAKAKSKTL--DFIDVLLLSEDKNGKELSDEDI 318
            :.|              |..||.|       :|.:.|....  |.|.:|:.:::::..:.:|::|
  Fly   244 IFD--------------SAKVDYFARLVVEAMQYREKHNITRPDMIQLLMEAKNESEDKWTDDEI 294

Human   319 RAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTM 383
            .|:...|.|...:..::.:....|.|..:|:.|||..:|:.|..|......:.:|.:.::.::.|
  Fly   295 VAQCFIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMDM 359

Human   384 CLKESLRLHPPIPTFARGCTQDVVLPDS--------RVIPKGNVCNINIFAIHHNPSVWPDPEVY 440
            .:.||||.........|.|::|..|.|.        :|   |:..||.|..:|.:...:|:|..:
  Fly   360 VISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKV---GDRINIPISGLHLDDRYFPEPRKF 421

Human   441 DPFRFDPENAQKRSPMAFIPFSAGPRNCIGQKFAMAEMKVVLALTLLRFRILPDHREPRRTPEIV 505
            ||.||..|......|..::||..|||||||.::|:.::|.:|...||.::|   ...||...::.
  Fly   422 DPDRFSEERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKI---EASPRTIKDLW 483

Human   506 LRA-------EDGLWLRVEP 518
            ..|       ..|.|:.:.|
  Fly   484 GSASGFNFTPRSGFWMHLVP 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F8NP_009184.1 p450 52..504 CDD:306555 114/482 (24%)
Cyp9b2NP_523646.1 p450 37..478 CDD:299894 113/479 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.