DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP4F8 and Cyp4s3

DIOPT Version :9

Sequence 1:NP_009184.1 Gene:CYP4F8 / 11283 HGNCID:2648 Length:520 Species:Homo sapiens
Sequence 2:NP_573003.2 Gene:Cyp4s3 / 32444 FlyBaseID:FBgn0030615 Length:495 Species:Drosophila melanogaster


Alignment Length:525 Identity:171/525 - (32%)
Similarity:280/525 - (53%) Gaps:69/525 - (13%)


- Green bases have known domain annotations that are detailed below.


Human    20 LLLLVVGASWL--LARILAWTYAFYHNGRRLRCFPQPRKQNWFLGHLGLVTPTEEGLRVLTQLVA 82
            |:..|:.|::|  |.:||        |..||:.|.:.           |..||      :.:|:|
  Fly     6 LVAFVLWAAFLRYLPKIL--------NFLRLQRFAKT-----------LPGPT------IGELIA 45

Human    83 TYPQG-FVRWL-------GPITPI-------INLCHPDIVRSVINTSDAITDKDIVFYKTLKPWL 132
            ...:| .:.||       ||:..|       :....|:.::.::..:..:|...  .|:.|:|||
  Fly    46 NVKKGEILNWLKELREKHGPVFRIWFGKDLMVMFTDPEDIKQLLGNNQLLTKSR--NYELLEPWL 108

Human   133 GDGLLLSVGDKWRHHRRLLTPAFHFNILKPYIKIFSKSANIMHAKWQRLAMEGSTCLDVFEHISL 197
            |.|||.:.|:.|...|:||||.|||.||..:.:...::..|: .:..|....|.: .|::.:|:|
  Fly   109 GKGLLTNGGESWHRRRKLLTPGFHFRILSEFKEPMEENCRIL-VRRLRTKANGES-FDIYPYITL 171

Human   198 MTLDSLQKCIFSFDSNCQ-EKPSEYITAIMELSALVVKRNNQFFRYKDFLYFLTPCGRRFHRACR 261
            ..||::.:.......:.| :..|||:.|:..:..::.|::..|::..:..:..|..|:....|.:
  Fly   172 FALDAICETAMGIKKHAQLQSDSEYVQAVQSICRVMHKQSFSFWQRLNVFFKHTKPGKEREAALK 236

Human   262 LVHDFTDAVIQERRRTLTS-------QGVDDFLQAKAKSKTLDFIDVLLLSEDKNGKELSDEDIR 319
            ::||.|:.||:.||..|..       :...|.:.||   :.|.|:|:|||::.:.|.||||.|||
  Fly   237 VLHDETNRVIRLRREQLIQERNEWKPEAEQDDVGAK---RRLAFLDMLLLTQMEGGAELSDTDIR 298

Human   320 AEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMC 384
            .|.|||||.|||||:|.:::.|..|:::|:.|:|..:|..||    |.:|.|     .:|:|...
  Fly   299 EEVDTFMFEGHDTTSSAIAFALSLLSKNPDVQQRAFEEASEL----EGREKE-----SMPYLEAV 354

Human   385 LKESLRLHPPIPTFARGCTQDVVLPDSRVIPKGNVCNINIFAIHHNPSVWPDPEVYDPFRFDPEN 449
            :||:||::|.:|.|:|...:|:.: ....:|||...:..|:.:|.:|..:||||.:||.|| ..|
  Fly   355 IKETLRIYPSVPFFSRKVLEDLEV-GKLTVPKGASISCLIYMLHRDPKNFPDPERFDPDRF-LVN 417

Human   450 AQKRSPMAFIPFSAGPRNCIGQKFAMAEMKVVLALTLLRFRILPD-HREPRRTPEIVLRAEDGLW 513
            .::..|.||..|||||||||||||||.|:|..||:.|..:|.||| ..:|:...|:|.::.:|:.
  Fly   418 EKQMHPFAFAAFSAGPRNCIGQKFAMLELKTSLAMLLRSYRFLPDKDHQPKPLAELVTKSGNGIR 482

Human   514 LRVEP 518
            ||:.|
  Fly   483 LRILP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP4F8NP_009184.1 p450 52..504 CDD:306555 154/475 (32%)
Cyp4s3NP_573003.2 p450 35..469 CDD:278495 154/457 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154672
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.