DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KLF8 and cbt

DIOPT Version :9

Sequence 1:NP_001311033.1 Gene:KLF8 / 11279 HGNCID:6351 Length:364 Species:Homo sapiens
Sequence 2:NP_722636.1 Gene:cbt / 33224 FlyBaseID:FBgn0043364 Length:428 Species:Drosophila melanogaster


Alignment Length:397 Identity:115/397 - (28%)
Similarity:167/397 - (42%) Gaps:94/397 - (23%)


- Green bases have known domain annotations that are detailed below.


Human     8 DMDKLI-----------NNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANP 61
            |||.|:           |.||:....|       :||..::.......:..:|.... .::..||
  Fly     2 DMDTLLPSPPATPPLRENKLEIVAKDE-------QQVNENLLKAKLKLVAQKSQKNG-GIITPNP 58

Human    62 MENPALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKP---------KAPLQPASMLQAPIRPPK 117
                   :|.:.|.||  :|.....|::|...:|...|         ||  :..|::........
  Fly    59 -------SDTEDEAPE--IAVPNKKPRLEQPAMSMTPPPDQKLDDDQKA--ERVSVIMRVNSSGA 112

Human   118 PQSSPQTLVVSTSTSDMSTSANIPTVLTPGSVLTSSQSTGSQQILHVIHTIPSV----------- 171
            ..||.|....|:|||..|:|:|..|            ||.|        ..|:|           
  Fly   113 VSSSSQDENSSSSTSCCSSSSNTNT------------STSS--------VPPTVEDDYPEANVWR 157

Human   172 SLPNKMGGLKTIPVVVQSLPMVYTTLPADGGPAAITVPLIGGDGKNAGSVK--VDPTSMSPLEIP 234
            :|..||...:...|   :||.|.|   .:...|.:..|....:......:|  :.|..:||  :.
  Fly   158 NLKFKMNRKRAAEV---ALPPVQT---PETPVAKLVTPPAPAECIKEEEIKPILTPIYVSP--VA 214

Human   235 SDSEESTIESGSSALQSLQGLQQEPAAMAQMQGEESLDLK---------RRRIHQCDFAGCSKVY 290
            |.:.:..:.|..:|.||     ..|........||.|..:         |.||::|.|..|.|.|
  Fly   215 SSASQLILLSTVAAQQS-----PTPVPKTPTMSEEKLTTRITAAQAAATRSRIYECSFPDCGKNY 274

Human   291 TKSSHLKAHRRIHTGEKPYKCTWDGCSWKFARSDELTRHFRKHTGIKPFRCTDCNRSFSRSDHLS 355
            .||||||||:|:||||:|:.|.|:.|..:|:|||||:||.|.|||.|.|:|:.|.:.|.||||||
  Fly   275 FKSSHLKAHQRVHTGERPFICKWENCDKRFSRSDELSRHKRTHTGEKKFQCSVCQKKFMRSDHLS 339

Human   356 LHRRRHD 362
            .|.:||:
  Fly   340 KHVKRHN 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KLF8NP_001311033.1 None
cbtNP_722636.1 zf-C2H2 263..287 CDD:278523 14/23 (61%)
C2H2 Zn finger 265..287 CDD:275368 14/21 (67%)
COG5048 <270..362 CDD:227381 46/77 (60%)
zf-H2C2_2 279..306 CDD:290200 15/26 (58%)
C2H2 Zn finger 295..317 CDD:275368 12/21 (57%)
zf-H2C2_2 309..332 CDD:290200 12/22 (55%)
zf-C2H2 323..345 CDD:278523 11/21 (52%)
C2H2 Zn finger 325..345 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.