DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TREX1 and REX4

DIOPT Version :10

Sequence 1:NP_338599.1 Gene:TREX1 / 11277 HGNCID:12269 Length:314 Species:Homo sapiens
Sequence 2:NP_014561.1 Gene:REX4 / 854075 SGDID:S000005440 Length:289 Species:Saccharomyces cerevisiae


Alignment Length:76 Identity:18/76 - (23%)
Similarity:30/76 - (39%) Gaps:10/76 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   195 HTAEGDVLALLSICQWRPQALLRWVDAHARPFGTIRPMYGVTASARTKPRPSAVTTTAHLATTRN 259
            |..:.|:.||:..   .|::|||....|. ||   |.:|   |..:|............::....
Yeast   204 HALKHDLEALMLS---HPKSLLRDTSRHL-PF---RKLY---AKGKTPSLKKLTREVLKISIQEG 258

Human   260 TSPSLGESRGT 270
            ...|:.::|.|
Yeast   259 EHSSVEDARAT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TREX1NP_338599.1 DnaQ_like_exo 14..211 CDD:447876 4/15 (27%)
Necessary for endoplasmic reticulum localization. /evidence=ECO:0000250|UniProtKB:Q91XB0 236..314 5/35 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..278 4/31 (13%)
Interaction with UBQLN1. /evidence=ECO:0000269|PubMed:23979357 243..314 3/28 (11%)
Necessary for cytoplasmic retention. /evidence=ECO:0000250|UniProtKB:Q91XB0 281..314
REX4NP_014561.1 REX4_like 122..274 CDD:99847 18/76 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.