| Sequence 1: | NP_338599.1 | Gene: | TREX1 / 11277 | HGNCID: | 12269 | Length: | 314 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_013208.1 | Gene: | REX3 / 850797 | SGDID: | S000004097 | Length: | 404 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 41 | Identity: | 13/41 - (31%) |
|---|---|---|---|
| Similarity: | 19/41 - (46%) | Gaps: | 9/41 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Human 87 LSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGD 127 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| TREX1 | NP_338599.1 | DnaQ_like_exo | 14..211 | CDD:447876 | 13/41 (32%) |
| Necessary for endoplasmic reticulum localization. /evidence=ECO:0000250|UniProtKB:Q91XB0 | 236..314 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 240..278 | ||||
| Interaction with UBQLN1. /evidence=ECO:0000269|PubMed:23979357 | 243..314 | ||||
| Necessary for cytoplasmic retention. /evidence=ECO:0000250|UniProtKB:Q91XB0 | 281..314 | ||||
| REX3 | NP_013208.1 | REX1_like | 244..390 | CDD:99848 | 13/41 (32%) |
| Blue background indicates that the domain is not in the aligned region. | |||||