DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TREX1 and CG3165

DIOPT Version :10

Sequence 1:NP_338599.1 Gene:TREX1 / 11277 HGNCID:12269 Length:314 Species:Homo sapiens
Sequence 2:NP_608732.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster


Alignment Length:329 Identity:78/329 - (23%)
Similarity:114/329 - (34%) Gaps:112/329 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    11 MQTLIFFDMEATGLPF---SQPKVTELCLLAVHRCAL--ESPPTSQGPPPTVPPPPRVVDKLSLC 70
            :.|....|:|.|.||.   ::..:||||:.|.....|  :.....|.....:|..|||:.||::.
  Fly    17 ISTFAVLDLETTNLPAYRNNRVSITELCIYAFEAALLKKKKKEQDQDEQQELPAAPRVLHKLNVL 81

Human    71 VAPGKACSPAASEITGLSTAVLAAHGRQCFDDNLANLLLAFLRRQPQPWCLVAHNGDRYDFPLLQ 135
            ..|.....|.|..|||||..:|....:  .|.:.|.|:::||:..|.|.|||||||..:|||:|:
  Fly    82 FQPSMVVDPEAERITGLSNYLLERESQ--LDTDAAQLIVSFLKHLPSPVCLVAHNGWGFDFPILR 144

Human   136 AELAMLG--LTSALDGAFCVDSI-------------------------------------TALKA 161
            .....|.  |..:|.   ||||:                                     |.||.
  Fly   145 QAFEKLNIELPQSLT---CVDSLRAFMEIDDTQQKETSQLKVPNDVQEIIPELKPKQNTETCLKE 206

Human   162 -----------------------------------------LERASSP----------------- 168
                                                     ||..:.|                 
  Fly   207 PEAVVNIDWRTRNETTPNRPILKPTEAFAKRKLLRDGDEDDLEEQTPPKRKPDEFRSRRQLFSGC 271

Human   169 -----SEHGPRKSYSLGSIYTRLYGQSPPDSHTAEGDVLALLSICQWRPQALLRWVDAHARPFGT 228
                 ..:.||..|:|.|:|||::......:|.||.||:....:.|......|.:.:..|.||..
  Fly   272 KCAENKRYPPRGVYNLESLYTRIFKIPALSAHQAEADVVMTTKLIQHYGIDFLAFAEEQAIPFQQ 336

Human   229 IRPM 232
            :.|:
  Fly   337 VVPL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TREX1NP_338599.1 DnaQ_like_exo 14..211 CDD:447876 72/303 (24%)
Necessary for endoplasmic reticulum localization. /evidence=ECO:0000250|UniProtKB:Q91XB0 236..314
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..278
Interaction with UBQLN1. /evidence=ECO:0000269|PubMed:23979357 243..314
Necessary for cytoplasmic retention. /evidence=ECO:0000250|UniProtKB:Q91XB0 281..314
CG3165NP_608732.1 TREX1_2 20..173 CDD:99839 52/157 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.