DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment USP18 and Usp47

DIOPT Version :9

Sequence 1:NP_059110.2 Gene:USP18 / 11274 HGNCID:12616 Length:372 Species:Homo sapiens
Sequence 2:NP_523937.2 Gene:Usp47 / 38644 FlyBaseID:FBgn0016756 Length:1556 Species:Drosophila melanogaster


Alignment Length:409 Identity:109/409 - (26%)
Similarity:175/409 - (42%) Gaps:74/409 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    34 SNMKREQPRERPRAWDYPHGLVGLHNIGQTCCLNSLIQVFVMNVDFTRILKRITVPRGADEQRRS 98
            |:...|...|..:|...|.|.|||.|...||.||||:|...|..:|...|.|.....  |.:.::
  Fly   375 SSATTETEAEARQASLGPRGYVGLVNQAMTCYLNSLLQALFMTPEFRNALYRWEFDN--DNEAKN 437

Human    99 VPFQMLLLLEKMQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVHLVER 163
            :|:|:..|...:|.|.:.||...:|.......:...:.|||..:|...:::.::.:..:......
  Fly   438 IPYQLQKLFLNLQTSPKAAVETTDLTRSFGWDSTEAWQQHDIQELCRVMFDALEHKFKNTKQANL 502

Human   164 LQALYTIRVKDSLICVDCAMESSRNSSMLTLPLSLFDV-DSKPLKTLEDALHCFFQPRELSSKSK 227
            :..||..::.|.:.|::|..|.:|..:.|.:||.:... .|....::|:||..|.||..|...::
  Fly   503 ISNLYEGKMNDYVKCLECNTEKTREDTFLDIPLPVRPFGSSSAYGSIEEALRAFVQPETLDGNNQ 567

Human   228 CFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNSQTR---KICHSLYFPQSLDF-------- 281
            ..||.|.||....:.|.....|..||:||.||.. :.||.   |:...:.|||:|:.        
  Fly   568 YLCEKCKKKCDAHKGLHFKSFPYILTLHLKRFDF-DYQTMHRIKLNDRVTFPQTLNLNTFINRSG 631

Human   282 ------SQI--------------------------------------------LPMKRESCDAEE 296
                  ||:                                            :.|...:..:.:
  Fly   632 NSGEQNSQLNGTVDDCSTADSGSAMEDDNLSSGVVTTASSSQHENDLNDEDEGIDMSSSTSKSAK 696

Human   297 QSGGQ--YELFAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCTYGNPN---- 355
            |..|.  |||||::.|.|.|..|||..||::..:.:||||||.|:..::.||||.::|.||    
  Fly   697 QGSGPYLYELFAIMIHSGSASGGHYYAYIKDFDNNEWFCFNDQNVTSITQEDIQRSFGGPNGSYY 761

Human   356 ---YHWQETAYLLVYMKME 371
               |.....||:|:|.:::
  Fly   762 SSAYTSSTNAYMLMYRQVD 780

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
USP18NP_059110.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..45 3/10 (30%)
Mediates interaction with IFNAR2. /evidence=ECO:0000269|PubMed:28165510 36..51 3/14 (21%)
Mediates interaction with STAT2. /evidence=ECO:0000269|PubMed:28165510 51..112 21/60 (35%)
UCH 55..367 CDD:306860 102/382 (27%)
Mediates interaction with STAT2 and necessary for the negative regulation of the type I IFN signaling pathway. /evidence=ECO:0000269|PubMed:28165510 303..312 5/8 (63%)
Mediates interaction with IFNAR2. /evidence=ECO:0000269|PubMed:28165510 313..372 25/66 (38%)
Usp47NP_523937.2 TEBP_beta <119..234 CDD:254188
Rib_recp_KP_reg 122..265 CDD:282899
peptidase_C19C 394..780 CDD:239124 104/388 (27%)
UCH 395..776 CDD:278850 102/383 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5077
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.