DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP12 and CG10089

DIOPT Version :9

Sequence 1:NP_009171.1 Gene:DUSP12 / 11266 HGNCID:3067 Length:340 Species:Homo sapiens
Sequence 2:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster


Alignment Length:254 Identity:64/254 - (25%)
Similarity:108/254 - (42%) Gaps:44/254 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    27 MLEVQPGLYFGGAAAVAEPDHLREAGITAVLTVDSEEPSFKAGPGVEDLWRLFVPALDKPETDLL 91
            |.:|.||||.|......:...|....|:.::.:.......     :.|...|.|.|.|.|:.:|.
  Fly     5 MGKVLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRL-----LPDKHYLCVMASDTPDQNLS 64

Human    92 SHLDRCVAFIGQARAEGRAVLVHCHAGVSRSVAIITAFLMKTDQLPFEKAYEKLQILKPEAKMNE 156
            .:...|..||..||.....||:||.||:||||.:..|::|....|.:::|.:.::..:..|..|.
  Fly    65 QYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNA 129

Human   157 GFEWQLKLYQAMGYEVDTSSAIYKQYRL----QKVTEKYPELQNLPQELFAVDPTTVSQGLKD-- 215
            ||:.||:.::              |::|    :::.|::|.     ..|..:|.|.|:..|.:  
  Fly   130 GFQSQLQEFE--------------QFKLSEERRRLRERFPS-----SALEQLDRTKVATALDNYQ 175

Human   216 EVLYKCRKCRRSLFRSSSI------LDHREGSGPIAFAHKRMTPSSMLTTGR-QAQCTS 267
            |:|.....|..:..|....      :|..:|    .|   |..||:..|..| :||.::
  Fly   176 ELLQNRDICEGNCSRGEKCPTGVCNMDPTKG----LF---RRRPSNASTHSRLRAQSSN 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP12NP_009171.1 DSPc 26..166 CDD:238073 41/138 (30%)
Substrate binding. /evidence=ECO:0000305|PubMed:24531476, ECO:0007744|PDB:4KI9 116..121 2/4 (50%)
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 41/138 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1042
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.