DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTGDR2 and TkR86C

DIOPT Version :9

Sequence 1:NP_004769.2 Gene:PTGDR2 / 11251 HGNCID:4502 Length:395 Species:Homo sapiens
Sequence 2:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster


Alignment Length:331 Identity:77/331 - (23%)
Similarity:150/331 - (45%) Gaps:40/331 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    37 LLHGLASLLGLVENGVILFVV-GCRMRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELG 100
            ::.||...:.:..||::|::| |.|..:||...::|:|:::|||.|:....|.:...:...|..|
  Fly    88 IIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLLMSSLNCVFNFIFMLNSDWPFG 152

Human   101 TTFCKLHSSIFFLNMFASGFLLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVL-WALAVLNTV 164
            :.:|.:::.:..:.:..|.|.|.|||.||.:.:|.|:   ..||.....::.||| |||:.:.:.
  Fly   153 SIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPL---KRRTSRRKVRIILVLIWALSCVLSA 214

Human   165 PYFVFRDTISRLDGRIMCYYN----VLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASS 225
            |..::...:::      .|||    .:.....||.....:....|..:...:|.:.:|:.::...
  Fly   215 PCLLYSSIMTK------HYYNGKSRTVCFMMWPDGRYPTSMADYAYNLIILVLTYGIPMIVMLIC 273

Human   226 HAAVSLRL------------QHRGRRRPGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGL 278
            ::.:...|            |....:...:.||:..|:|:.||:||.|||:|.:.....:.....
  Fly   274 YSLMGRVLWGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICWLPYHLFFIYAYHNNQVAST 338

Human   279 RPLVWRGLPFVTSLAFFNSVANPVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRR 343
            :.:....|.|.. ||..|::.||::|..    |.::.|...:.::....|        |.:|.|.
  Fly   339 KYVQHMYLGFYW-LAMSNAMVNPLIYYW----MNKRFRMYFQRIICCCCV--------GLTRHRF 390

Human   344 TSSTAR 349
            .|..:|
  Fly   391 DSPKSR 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTGDR2NP_004769.2 7tm_1 49..304 CDD:278431 66/272 (24%)
Involved in the recycling of CRTH2 330..333 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..363 5/17 (29%)
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 70/297 (24%)
7tm_1 100..363 CDD:278431 66/272 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.