DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GPR45 and moody

DIOPT Version :9

Sequence 1:NP_009158.3 Gene:GPR45 / 11250 HGNCID:4503 Length:372 Species:Homo sapiens
Sequence 2:NP_001188534.1 Gene:moody / 31168 FlyBaseID:FBgn0025631 Length:670 Species:Drosophila melanogaster


Alignment Length:384 Identity:87/384 - (22%)
Similarity:152/384 - (39%) Gaps:74/384 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     7 SLE-AYTYLLLNTSNASDSGSTQLPAPLRISLAIVMLLMTVVGFLGNTVVCIIVYQRPAMRSAIN 70
            ||| .|..|...|:....:.:|.....|....|::..|:.:||..||.:..:.:.:.|.:|:...
  Fly     8 SLEDGYPPLEALTTMVPPADATGFSQSLLTFAAVMTFLIMIVGICGNLLTVVALLKCPKVRNVAA 72

Human    71 LLLATLAFSDIMLSLCCMPFTAVTLITVRWHFGDHFCRLSATLYWFFVLEGVAILLI--ISVDRF 133
            ..:.:|..:|::.....:||..:..:...|..|...|||...:.:..:  ||::|.|  |:::|:
  Fly    73 AFIISLCIADLLFCALVLPFQGLRFVQGTWRHGQVLCRLIPFIQYGNI--GVSLLCIAMITINRY 135

Human   134 LIIVQRQDKLNPRRAK-----VIIAVSWVLSFCIAGPSLTG-WTLVEVPARAPQCVLGYTELPAD 192
            ::|...  .|..|..|     |:||..|:.|:.:..|:|.| |......:|...|.:    :..|
  Fly   136 VMITHH--GLYARIYKRHWIAVMIAACWLFSYGMQLPTLLGEWGRFGYDSRLQTCSI----MTDD 194

Human   193 RAY--VVTLVVAVFFAPFGVMLCAYMCILNTVRKNAVRVH---NQSDSL--DLRQLTRAGLRRL- 249
            ..:  ..||.:..|..|..|::..|..|...|.|:..|:.   .:.:|:  :||.|...|...| 
  Fly   195 HGHSSKTTLFITAFVIPCLVIIACYAKIFWVVHKSEQRLKRHATKQNSIPNNLRPLASTGSGALP 259

Human   250 -----QRQQQVSVDLSFK----------------------------------TKAFTTILILFVG 275
                 |...:||.|.|..                                  ||   .:|.:|:.
  Fly   260 SGAECQPSNRVSSDSSSSFSIDVPETAPSGKQQPTRVKDQREVRAKRNEWRITK---MVLAIFLS 321

Human   276 FSLCWLPHSVYSLLSVFSQRFYCGSSFYATSTCVLWLSYLKSVFNPIVYCWRIKKFREA 334
            |.:|:||.::..:...       .....:...|...|.||.:..|||:|....|::|:|
  Fly   322 FVVCYLPITIVKVADK-------NVEHPSLHICSYILLYLSACINPIIYVIMNKQYRKA 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GPR45NP_009158.3 7tmA_GPR45 35..335 CDD:320525 79/355 (22%)
TM helix 1 36..62 CDD:320525 6/25 (24%)
TM helix 2 69..92 CDD:320525 4/22 (18%)
TM helix 3 107..137 CDD:320525 9/31 (29%)
TM helix 4 146..168 CDD:320525 8/26 (31%)
TM helix 5 192..221 CDD:320525 8/30 (27%)
TM helix 6 260..290 CDD:320525 9/63 (14%)
TM helix 7 303..328 CDD:320525 8/24 (33%)
moodyNP_001188534.1 7tm_4 44..>167 CDD:304433 31/126 (25%)
7tm_1 53..363 CDD:278431 71/327 (22%)
7tm_4 <310..380 CDD:304433 19/74 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.