DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RASSF8 and meru

DIOPT Version :9

Sequence 1:NP_001158218.1 Gene:RASSF8 / 11228 HGNCID:13232 Length:419 Species:Homo sapiens
Sequence 2:NP_001246779.1 Gene:meru / 39727 FlyBaseID:FBgn0052150 Length:524 Species:Drosophila melanogaster


Alignment Length:408 Identity:78/408 - (19%)
Similarity:159/408 - (38%) Gaps:73/408 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     2 ELKVWV-DGVQRIVCGVTEVTTCQEVVIALAQAIGRTGR-------------------------Y 40
            |:.:|: ||..|.|.|||..|||.:::.||.....|.|.                         |
  Fly   124 EIPIWMDDGEARYVSGVTNKTTCDDIIKALIDDELRNGNGFYCGNNPKDGGQRKTAAASRDYSDY 188

Human    41 TLIEKWRDTERHLAPHENPIISLNKWGQYASDVQLILRRTG-----------PSLSERPTSDSVA 94
            .:.|.|...||....:...:.....|.:..:::::.|:...           |. |:..|..|:.
  Fly   189 IITESWGGIERCYDGNMAILPVWRAWSRVHNELRISLKHRDSFRDPLAMQLVPH-SQSATGFSMY 252

Human    95 RIPERTLY----RQSLPPLAKLRPQIDKSIKRREPKRKSLTFTGGAKGLM--DIFGKGKETEFKQ 153
            :..::.|:    :::.|...|..|::...:|.:....:..|.|.....::  |...:|.|...|.
  Fly   253 KWLKKLLHLKKGKKTPPKPTKTPPKVPNKLKEKRVHGQKQTMTNDLVLVIMPDQLYRGTENTAKS 317

Human   154 KVLNNCKTTADELKKLIRLQTEKLQSIEKQLESNEIEIRFWEQKYNSNLEEEIVRLEQKIKRNDV 218
            |:.   |...:.:.|....:..:.:..:..:|:....|.......|.|:...|.|.:.|..||.|
  Fly   318 KLY---KLAENRVSKQRHRRRSRHEITKASVETFRTAIPSECNNNNYNVNNCIRRRKDKPLRNSV 379

Human   219 EIEEEEFWENELQIEQENEKQLKDQLQEIRQKITECENKLKDYLAQIRTMESGLEAEKLQREVQE 283
            ..:.... ..::.:..|.|..|..||.|: .::...:|:      :.:..|..|...:||:.::.
  Fly   380 RYKLASL-HADMNVRYEKEHALTRQLSEM-CRLYRLQNE------RYKGPEMELSVGQLQQNIEA 436

Human   284 AQVNEEEVKGKIGKVKGEIDIQGQQSLRLENGIK-----------AVERSLGQATKRLQDKEQ-- 335
            ...:..:.:.::.::|.||    :..:.|.|.:|           |.::...:.|..||:.|.  
  Fly   437 YAEDIIKTEHELLELKNEI----KHDISLINNLKRLTLEESEADAACKKGAAKITHPLQENENTP 497

Human   336 ELEQLTKELRQV-NLQQF 352
            ::.:.|:|::.| |:.:|
  Fly   498 QVAKNTQEMQFVDNIYEF 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RASSF8NP_001158218.1 RA_RASSF8 2..83 CDD:340551 23/117 (20%)
Smc <160..>351 CDD:224117 38/204 (19%)
meruNP_001246779.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1574
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15286
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.