DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUSP10 and CG10089

DIOPT Version :9

Sequence 1:NP_009138.1 Gene:DUSP10 / 11221 HGNCID:3065 Length:482 Species:Homo sapiens
Sequence 2:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster


Alignment Length:148 Identity:53/148 - (35%)
Similarity:80/148 - (54%) Gaps:15/148 - (10%)


- Green bases have known domain annotations that are detailed below.


Human   319 NAELTPILPFLFLGNEQDAQDLDTMQRLNIGYVINVTTH------LPLYHYEKGLFNYKRLPATD 377
            |..:..:||.|::||.:|::|...::|..|.::|.:  |      ||..|       |..:.|:|
  Fly     2 NWHMGKVLPGLYVGNYRDSKDHAQLERFKISHIIAI--HDSPRRLLPDKH-------YLCVMASD 57

Human   378 SNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKR 442
            :..|||.|||....:||..|......:||||.||:|||.|:.:||:|..|.:...:|.|.|:..|
  Fly    58 TPDQNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGR 122

Human   443 PIISPNLNFMGQLLEFEE 460
            .:.:||..|..||.|||:
  Fly   123 AVANPNAGFQSQLQEFEQ 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUSP10NP_009138.1 DSP_MapKP 149..284 CDD:238723
Interaction with MAP kinases 199..215
DSPc 321..459 CDD:238073 50/143 (35%)
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 50/143 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.