Sequence 1: | NP_009128.1 | Gene: | FZD10 / 11211 | HGNCID: | 4039 | Length: | 581 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_610297.2 | Gene: | Corin / 35691 | FlyBaseID: | FBgn0033192 | Length: | 1397 | Species: | Drosophila melanogaster |
Alignment Length: | 234 | Identity: | 55/234 - (23%) |
---|---|---|---|
Similarity: | 88/234 - (37%) | Gaps: | 64/234 - (27%) |
- Green bases have known domain annotations that are detailed below.
Human 27 ERPGDGKCQPIEIPMCK--DIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCS 89
Human 90 LYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDC---RKLPNKNDPNYLCMEAP 151
Human 152 NNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGG--------PGRGGCDNPGKFHHVE------ 202
Human 203 --KSASCAP---------------LCTPGVDVYWSREDK 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FZD10 | NP_009128.1 | CRD_FZ10 | 30..156 | CDD:143571 | 38/130 (29%) |
7tmF_FZD10 | 217..535 | CDD:320165 | 0/8 (0%) | ||
TM helix 1 | 226..251 | CDD:320165 | |||
TM helix 2 | 260..281 | CDD:320165 | |||
TM helix 3 | 310..336 | CDD:320165 | |||
TM helix 4 | 353..369 | CDD:320165 | |||
TM helix 5 | 391..420 | CDD:320165 | |||
TM helix 6 | 440..467 | CDD:320165 | |||
TM helix 7 | 497..522 | CDD:320165 | |||
Lys-Thr-X-X-X-Trp motif, mediates interaction with the PDZ domain of Dvl family members. /evidence=ECO:0000250 | 526..531 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 560..581 | ||||
PDZ-binding | 579..581 | ||||
Corin | NP_610297.2 | CRD_FZ | 778..894 | CDD:143549 | 36/125 (29%) |
LDLa | 911..942 | CDD:238060 | 6/35 (17%) | ||
LDLa | 945..979 | CDD:238060 | 4/33 (12%) | ||
SR | 980..>1034 | CDD:214555 | |||
SRCR | 992..1086 | CDD:278931 | |||
Tryp_SPc | 1103..1343 | CDD:214473 | |||
Tryp_SPc | 1104..1346 | CDD:238113 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3577 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |