| Sequence 1: | NP_000381.1 | Gene: | CHM / 1121 | HGNCID: | 1940 | Length: | 653 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001022928.1 | Gene: | rep-1 / 175311 | WormBaseID: | WBGene00022051 | Length: | 510 | Species: | Caenorhabditis elegans |
| Alignment Length: | 39 | Identity: | 12/39 - (30%) |
|---|---|---|---|
| Similarity: | 18/39 - (46%) | Gaps: | 17/39 - (43%) |
- Green bases have known domain annotations that are detailed below.
|
Human 49 CKVLVIGAGGLGCELLKNLALSGFRQIHVIDMDTIDVSN 87 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CHM | NP_000381.1 | NAD_binding_8 | 13..>54 | CDD:433218 | 2/4 (50%) |
| Rossmann-fold NAD(P)(+)-binding proteins | 225..542 | CDD:473865 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 606..653 | ||||
| rep-1 | NP_001022928.1 | Rossmann-fold NAD(P)(+)-binding proteins | 1..>361 | CDD:473865 | 12/39 (31%) |
| Blue background indicates that the domain is not in the aligned region. | |||||