Sequence 1: | NP_009015.1 | Gene: | SOX21 / 11166 | HGNCID: | 11197 | Length: | 276 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_651839.1 | Gene: | Sox100B / 45039 | FlyBaseID: | FBgn0024288 | Length: | 529 | Species: | Drosophila melanogaster |
Alignment Length: | 317 | Identity: | 94/317 - (29%) |
---|---|---|---|
Similarity: | 129/317 - (40%) | Gaps: | 106/317 - (33%) |
- Green bases have known domain annotations that are detailed below.
Human 6 DHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMK 70
Human 71 EHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAG--------LHAGAGGGLVP 127
Human 128 ESLLANPEKAAAAAAAAA-----------ARV------FFPQSAAAAAAAAAAAAAGSPYSLLDL 175
Human 176 G--SKMAEISSSSSGLPYAS----------------------SLGYPTAGAGAFHG--------- 207
Human 208 ------------AAAAAAAAAAAA-------------GGHTHSHPSPGNPGYMIPCN 239 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SOX21 | NP_009015.1 | SOX-TCF_HMG-box | 7..78 | CDD:238684 | 40/70 (57%) |
SOXp | 77..>95 | CDD:403523 | 6/17 (35%) | ||
Sox100B | NP_651839.1 | SOX-TCF_HMG-box | 76..146 | CDD:238684 | 39/69 (57%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0527 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000028 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |