DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX21 and Sox100B

DIOPT Version :9

Sequence 1:NP_009015.1 Gene:SOX21 / 11166 HGNCID:11197 Length:276 Species:Homo sapiens
Sequence 2:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster


Alignment Length:317 Identity:94/317 - (29%)
Similarity:129/317 - (40%) Gaps:106/317 - (33%)


- Green bases have known domain annotations that are detailed below.


Human     6 DHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMK 70
            :|:||||||||||::|.||.|:::.|.:.|||:||.||..||.|.:|:|:||::.|::||..|.:
  Fly    75 EHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQ 139

Human    71 EHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAG--------LHAGAGGGLVP 127
            |||||||:||||...:|                     |:.::|.|        |.|..|....|
  Fly   140 EHPDYKYQPRRKKARVL---------------------PSQQSGEGGSPGPEMTLSATMGSSGKP 183

Human   128 ESLLANPEKAAAAAAAAA-----------ARV------FFPQSAAAAAAAAAAAAAGSPYSLLDL 175
            .|..:|.::.|....|||           |.|      .|...|...:..:|.||:....||::.
  Fly   184 RSSNSNGQRRAGKGNAAADLGSCASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIET 248

Human   176 G--SKMAEISSSSSGLPYAS----------------------SLGYPTAGAGAFHG--------- 207
            |  |..:..||.||..|.|:                      .|..|.|.||..:|         
  Fly   249 GLDSPCSTASSMSSLTPPATPYNVAPSNAKASAANNPSLLLRQLSEPVANAGDGYGVLLEAGREY 313

Human   208 ------------AAAAAAAAAAAA-------------GGHTHSHPSPGNPGYMIPCN 239
                        |...:.|....|             ||:|.|..|  .|.|..|.|
  Fly   314 VAIGEVNYQGQSAGVQSGAEGGGAGQEMDFLENINGYGGYTGSRVS--YPAYSYPAN 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX21NP_009015.1 SOX-TCF_HMG-box 7..78 CDD:238684 40/70 (57%)
SOXp 77..>95 CDD:403523 6/17 (35%)
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 39/69 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.