DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX21 and Sox102F

DIOPT Version :9

Sequence 1:NP_009015.1 Gene:SOX21 / 11166 HGNCID:11197 Length:276 Species:Homo sapiens
Sequence 2:NP_001014695.1 Gene:Sox102F / 43844 FlyBaseID:FBgn0039938 Length:618 Species:Drosophila melanogaster


Alignment Length:228 Identity:71/228 - (31%)
Similarity:102/228 - (44%) Gaps:58/228 - (25%)


- Green bases have known domain annotations that are detailed below.


Human     2 SKPVDHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRA 66
            |||  |:||||||||||::.:|||:.:..|.||||.|||.|||.||.::.::|:|:.:|..||..
  Fly   419 SKP--HIKRPMNAFMVWAKDERRKILKACPDMHNSNISKILGARWKAMSNADKQPYYEEQSRLSK 481

Human    67 MHMKEHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAGLHAGAGGGLVPESLL 131
            :||::||||:||||.|...::...|........|.....||...|....|..:|..|.|..::. 
  Fly   482 LHMEQHPDYRYRPRPKRTCIVDGKKMRISEYKVLMRNRRAEMRQLWCRTGGVSGGSGSLCADAC- 545

Human   132 ANPEKAAAAAAAAAARVFFPQSAAAAAAAAAAAAAGSPYSLLDLGSKMAEISSSSSGLPYASSLG 196
                               |:.:..:.:..|.|||.:.|.|.|:                     
  Fly   546 -------------------PKGSGGSNSQVAVAAAAAVYHLQDM--------------------- 570

Human   197 YPTAGAGAFHGAAAAAAAAAAAAGGHTHSHPSP 229
                           |::||:.|.||...|..|
  Fly   571 ---------------ASSAASTAHGHDCGHTPP 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX21NP_009015.1 SOX-TCF_HMG-box 7..78 CDD:238684 38/70 (54%)
SOXp 77..>95 CDD:403523 6/17 (35%)
Sox102FNP_001014695.1 SOX-TCF_HMG-box 422..493 CDD:238684 38/70 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.