DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX21 and Sox21b

DIOPT Version :9

Sequence 1:NP_009015.1 Gene:SOX21 / 11166 HGNCID:11197 Length:276 Species:Homo sapiens
Sequence 2:NP_001261829.1 Gene:Sox21b / 39569 FlyBaseID:FBgn0042630 Length:587 Species:Drosophila melanogaster


Alignment Length:315 Identity:123/315 - (39%)
Similarity:146/315 - (46%) Gaps:105/315 - (33%)


- Green bases have known domain annotations that are detailed below.


Human     6 DHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMK 70
            :|:||||||||||||.||||:||:||||||||||||||||||||||.||||||||||||||||||
  Fly   246 EHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEISKRLGAEWKLLTEEEKRPFIDEAKRLRAMHMK 310

Human    71 EHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAG------------AGLHAGAGG 123
            ||||||||||||||. |::|.:.:|:||     ......||:||            |..|.|:..
  Fly   311 EHPDYKYRPRRKPKA-LRRDGYPYPMPY-----PSVPVEALRAGITPGYFAPGPTAAAYHLGSHL 369

Human   124 G--------------------LVPESLLANPEKAAAAAA--------------------AA---- 144
            |                    |...|.|:|..:|:|.:|                    ||    
  Fly   370 GQTSTPTTTQATLSGQMDKFALERSSYLSNSSQASAYSAYLDPSVLTKAYFDSKMYQDRAANYAF 434

Human   145 -AARVFFPQSAAAA---------------------AAAAAAAAAGSPYS---------------- 171
             .::::..|..|||                     :....:...||..|                
  Fly   435 DISKIYGAQQHAAAHHQQQQQQQQQQQQQQQQLLLSGGGGSGGGGSASSHNNNSSSGLDDRDATP 499

Human   172 -LLDLGSKMAEISSSSSGLPYASSL----GYPTAGAGAFHGAAAAAAAAAAAAGG 221
             |..:.||....|.|..||.||...    |...|.||...|..||.||..:|.||
  Fly   500 QLEAVESKPHLHSPSDVGLDYAQYAQQYGGQLAAAAGGAVGGGAAGAAGGSAGGG 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX21NP_009015.1 SOX-TCF_HMG-box 7..78 CDD:238684 65/70 (93%)
SOXp 77..>95 CDD:403523 10/17 (59%)
Sox21bNP_001261829.1 SOX-TCF_HMG-box 247..318 CDD:238684 65/70 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160113
Domainoid 1 1.000 139 1.000 Domainoid score I4785
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 1 1.000 - - otm41974
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.