Sequence 1: | NP_009015.1 | Gene: | SOX21 / 11166 | HGNCID: | 11197 | Length: | 276 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261829.1 | Gene: | Sox21b / 39569 | FlyBaseID: | FBgn0042630 | Length: | 587 | Species: | Drosophila melanogaster |
Alignment Length: | 315 | Identity: | 123/315 - (39%) |
---|---|---|---|
Similarity: | 146/315 - (46%) | Gaps: | 105/315 - (33%) |
- Green bases have known domain annotations that are detailed below.
Human 6 DHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMK 70
Human 71 EHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAG------------AGLHAGAGG 123
Human 124 G--------------------LVPESLLANPEKAAAAAA--------------------AA---- 144
Human 145 -AARVFFPQSAAAA---------------------AAAAAAAAAGSPYS---------------- 171
Human 172 -LLDLGSKMAEISSSSSGLPYASSL----GYPTAGAGAFHGAAAAAAAAAAAAGG 221 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SOX21 | NP_009015.1 | SOX-TCF_HMG-box | 7..78 | CDD:238684 | 65/70 (93%) |
SOXp | 77..>95 | CDD:403523 | 10/17 (59%) | ||
Sox21b | NP_001261829.1 | SOX-TCF_HMG-box | 247..318 | CDD:238684 | 65/70 (93%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165160113 | |
Domainoid | 1 | 1.000 | 139 | 1.000 | Domainoid score | I4785 |
eggNOG | 1 | 0.900 | - | - | E1_KOG0527 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000028 | |
OrthoInspector | 1 | 1.000 | - | - | otm41974 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10270 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R685 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
9 | 8.830 |