DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX21 and Sox14

DIOPT Version :10

Sequence 1:NP_009015.1 Gene:SOX21 / 11166 HGNCID:11197 Length:276 Species:Homo sapiens
Sequence 2:NP_476894.1 Gene:Sox14 / 37822 FlyBaseID:FBgn0005612 Length:669 Species:Drosophila melanogaster


Alignment Length:76 Identity:44/76 - (57%)
Similarity:64/76 - (84%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     7 HVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMKE 71
            |:|||||||||||:.:|||:.:..|.:||:||||.||..|:||::.:|:|:|.||::||.:||.|
  Fly   186 HIKRPMNAFMVWSQMERRKICERTPDLHNAEISKELGRRWQLLSKDDKQPYIIEAEKLRKLHMIE 250

Human    72 HPDYKYRPRRK 82
            :|:|||||::|
  Fly   251 YPNYKYRPQKK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX21NP_009015.1 HMG-box_SoxB 6..85 CDD:438790 44/76 (58%)
SOXp 77..>95 CDD:463537 4/6 (67%)
Sox14NP_476894.1 HMG-box_SoxC 186..261 CDD:438838 43/74 (58%)

Return to query results.
Submit another query.