DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SOX21 and bbx

DIOPT Version :9

Sequence 1:NP_009015.1 Gene:SOX21 / 11166 HGNCID:11197 Length:276 Species:Homo sapiens
Sequence 2:NP_001027087.1 Gene:bbx / 3772670 FlyBaseID:FBgn0024251 Length:769 Species:Drosophila melanogaster


Alignment Length:296 Identity:62/296 - (20%)
Similarity:100/296 - (33%) Gaps:72/296 - (24%)


- Green bases have known domain annotations that are detailed below.


Human     2 SKPVDHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRA 66
            ::|..|.:||||||:::.:..|..:.:....:.|..|:|.||..|..|.|.||..|.|.|::.:.
  Fly   291 TRPEHHARRPMNAFLIFCKRHRGIVKERYKTLENRAITKILGDWWAALDEQEKHCFTDLAQQNKD 355

Human    67 MHMKEHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAGLHAGAGGGL------ 125
            .....:|::|:              :..|.            |.|:..|...:.|..||      
  Fly   356 AFFNANPNFKW--------------YKLPA------------PPLRTLATRPSNASAGLLIPSED 394

Human   126 -----VPESL---------------------LANPEKAAAAAAAAAARV----FFPQSA------ 154
                 ||.||                     ||:..:....::....:|    |..|..      
  Fly   395 QPQQQVPTSLQVQWAERGEMPRAMLRPNYFKLADETQMGELSSLLQVQVQEKDFALQQVLSETSQ 459

Human   155 --AAAAAAAAAAAAGSPYSLLDLGSKMAEISSSSSGLPYASSLGYPTAGAGAFHGAAAAAAAAAA 217
              :|...|......|:..||.|..|..:....::||......:....:..|..:.....:...||
  Fly   460 FLSAHMPAGNTNGNGNKRSLQDNNSSNSSEEEAASGSSPNKKVKSSRSCKGKIYQELVNSGQLAA 524

Human   218 AAGGHTHSHPSPGN-PGYMIPCNCSAWP-SPGLQPP 251
            .|.......|..|| .|..:.....|.| :|.:.||
  Fly   525 IAKKSKARLPPAGNMGGNFVDIPLDAGPNTPPVSPP 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SOX21NP_009015.1 SOX-TCF_HMG-box 7..78 CDD:238684 23/70 (33%)
SOXp 77..>95 CDD:403523 0/17 (0%)
bbxNP_001027087.1 SOX-TCF_HMG-box 296..367 CDD:238684 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.