powered by:
Protein Alignment LSM6 and SmF
DIOPT Version :9
Sequence 1: | NP_009011.1 |
Gene: | LSM6 / 11157 |
HGNCID: | 17017 |
Length: | 80 |
Species: | Homo sapiens |
Sequence 2: | NP_523708.2 |
Gene: | SmF / 36314 |
FlyBaseID: | FBgn0000426 |
Length: | 88 |
Species: | Drosophila melanogaster |
Alignment Length: | 66 |
Identity: | 32/66 - (48%) |
Similarity: | 42/66 - (63%) |
Gaps: | 0/66 - (0%) |
- Green bases have known domain annotations that are detailed below.
Human 8 PSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLY 72
|..||..:.|:||:|||..|.:|:|.|..:|||||:.|..|||.:.|.:....|:..||.|||||
Fly 9 PKPFLNGLTGKPVLVKLKWGQEYKGFLVSVDGYMNMQLANTEEVIEGSVTGNLGEVLIRCNNVLY 73
Human 73 I 73
|
Fly 74 I 74
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
LSM6 | NP_009011.1 |
LSm6 |
7..74 |
CDD:212473 |
32/66 (48%) |
SmF | NP_523708.2 |
Sm_F |
8..76 |
CDD:212469 |
32/66 (48%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000850 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.