DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LSM6 and SmF

DIOPT Version :9

Sequence 1:NP_009011.1 Gene:LSM6 / 11157 HGNCID:17017 Length:80 Species:Homo sapiens
Sequence 2:NP_523708.2 Gene:SmF / 36314 FlyBaseID:FBgn0000426 Length:88 Species:Drosophila melanogaster


Alignment Length:66 Identity:32/66 - (48%)
Similarity:42/66 - (63%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     8 PSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLY 72
            |..||..:.|:||:|||..|.:|:|.|..:|||||:.|..|||.:.|.:....|:..||.|||||
  Fly     9 PKPFLNGLTGKPVLVKLKWGQEYKGFLVSVDGYMNMQLANTEEVIEGSVTGNLGEVLIRCNNVLY 73

Human    73 I 73
            |
  Fly    74 I 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LSM6NP_009011.1 LSm6 7..74 CDD:212473 32/66 (48%)
SmFNP_523708.2 Sm_F 8..76 CDD:212469 32/66 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000850
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.