DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KAT7 and CG1894

DIOPT Version :9

Sequence 1:NP_008998.1 Gene:KAT7 / 11143 HGNCID:17016 Length:611 Species:Homo sapiens
Sequence 2:NP_651620.1 Gene:CG1894 / 43378 FlyBaseID:FBgn0039585 Length:421 Species:Drosophila melanogaster


Alignment Length:423 Identity:141/423 - (33%)
Similarity:219/423 - (51%) Gaps:34/423 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   214 NLSADECKVRAQSRDKQIEERM--------LSHRQDDNNRHATRHQAPTERQLRYKEKVAELRKK 270
            |.|.|..|.:.......|..::        |::.::.:   |||...    |...|.::.:.:.:
  Fly     5 NRSGDHLKYQPLGDQDGISSKLPDIPRALQLTNAKESS---ATRGLG----QSASKSEMGKSQLQ 62

Human   271 RNSGLSKE-QKEKYME----HRQTYGNTREPLLENLTSEYDLDLFRR--------AQARASEDLE 322
            .:|.|.|. |:.|.:.    ..|..|.|.:..||.:.....:.|...        .|.:.:.|.|
  Fly    63 NDSSLQKNIQETKTITGSCIEAQRIGATPKKQLEGVKEPNMISLLHTNASSNVDDRQRQETIDNE 127

Human   323 KLRLQGQITEGS----NMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRR 383
            |..:|.:..:..    ..|:.:.|||||::|...||||....:...:|:||||||||..:.....
  Fly   128 KSDVQKEKEDAKVKVIRNIEKVQFGRYEIETTSSSPYPVINDKATTIYVCEFCLKYMCLRKSYSY 192

Human   384 HMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTE 448
            |:..|..:.|||..:|||.:|.::||||.|.::|||.|||::||||::|.:.|....||||::..
  Fly   193 HLYDCKKRCPPGSLLYRKDNIYIYEVDGHKEQLYCQCLCLMSKLFLENKKILYSSSSFLFYILCL 257

Human   449 ADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSD 513
            .|..|.|..|||::|| :.||.|::|||.:|.|||:||||:|||.||.:|:.|..:|.|::|||.
  Fly   258 KDKDGEHFAGYFAREK-TMLNINLNCILVLPPYMRKGYGKLLIDLSYEISRREACIGGPKKPLSK 321

Human   514 LGLISYRSYWKEVLLRYL-HNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKR 577
            :..:.|.|||..:||..| |:.....::|:|:|:.|.....||:|||:.:.|.||:|..|::...
  Fly   322 VARLCYLSYWGHILLNLLRHHSSPDLVTIEELSKATGFREEDIISTLEFMGMTKYYKVDHIMFYT 386

Human   578 QDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKG 610
            ...|.|.....|:......|:..:.|.|..|.|
  Fly   387 TSSIIEDRRGLAQFKKPRLTIHRNRLSWKTPTG 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KAT7NP_008998.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..173
zf-C2HC 184..212 CDD:396216
PLN00104 <324..609 CDD:215056 113/289 (39%)
acetyl-CoA binding. /evidence=ECO:0000269|PubMed:28334966, ECO:0000269|PubMed:31827282, ECO:0007744|PDB:5GK9, ECO:0007744|PDB:6MAK 475..477 1/1 (100%)
WM-3835 inhibitor binding. /evidence=ECO:0000269|PubMed:31827282, ECO:0007744|PDB:6MAJ 483..488 3/4 (75%)
acetyl-CoA binding. /evidence=ECO:0000269|PubMed:28334966, ECO:0000269|PubMed:31827282, ECO:0007744|PDB:5GK9, ECO:0007744|PDB:6MAK 483..488 3/4 (75%)
CG1894NP_651620.1 NAT_SF 130..395 CDD:302625 109/265 (41%)
MOZ_SAS 202..378 CDD:280097 82/176 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D629545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.