DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IL1RAPL1 and Dscam2

DIOPT Version :9

Sequence 1:NP_055086.1 Gene:IL1RAPL1 / 11141 HGNCID:5996 Length:696 Species:Homo sapiens
Sequence 2:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster


Alignment Length:552 Identity:124/552 - (22%)
Similarity:193/552 - (34%) Gaps:167/552 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    42 QVLVGEPVRIKCALFYGYI-------RTNYSLAQSAGLSLM------------WYKSSGPGDFEE 87
            ||:|..|.|::.....|.|       ..:..::|..|..|:            |:..:|.|..  
  Fly   218 QVVVSSPTRLRINSHRGIISPSVVEHTAHVQVSQDEGAVLLCVAQGCPSPEYSWFTHNGAGPL-- 280

Human    88 PIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFE 152
            |: ..|.|:......:.......:|||:|.|...|........:.|||.   |.:          
  Fly   281 PV-LSGPRVRLLGPILAIEAVTGEDSGVYKCTAGNVGGEASAELRLTVA---TPI---------- 331

Human   153 KAELSK---------SKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVRE 208
            :.|:|.         :.|..|. :.....|.....|||||:.|.   .||.....|||::..|..
  Fly   332 QVEISPNVLSVHMGGTAEFRCL-VTSNGSPVGMQNILWYKDGRQ---LPSSGRVEDTLVVPRVSR 392

Human   209 DDIGNYTCELKYGGFVVRR----TTELTVTAPLTDKPPKLLYPMESKLTIQET-QLGDSANLTCR 268
            ::.|.|.|       ||||    |.:.|....|.|.||.|||..     |::| |.|.:.:|.|.
  Fly   393 ENRGMYQC-------VVRRPEGDTFQATAELQLGDAPPVLLYSF-----IEQTLQPGPAVSLKCS 445

Human   269 AFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHL---GE--QEVSISLIVDSVEEGD 328
            |    :|:.:|.|.|        .||...:..:...::.:::   |:  ..|:||.::  ||:| 
  Fly   446 A----AGNPTPQISW--------TLDGFPLPSNGRFMIGQYITVHGDVISHVNISHVM--VEDG- 495

Human   329 LGNYSCYVENGNGRRHASVLLHKRELMYTVELAGGLGAI---LLLLVCLVTIYKCYKIEIMLFYR 390
             |.|:|..||..||...:..|:...|.| :.|...:.|:   .|.|.|.|..|...:|       
  Fly   496 -GEYACIAENRAGRVQHAARLNIYGLPY-IRLIPKVTAVSGETLNLKCPVAGYPIEEI------- 551

Human   391 NHF--GAEELDGD------------------NKDYDAYLSYT--------------------KVD 415
             |:  |..||..|                  |.|...|..:.                    |:.
  Fly   552 -HWERGGRELPDDIRQRVQPDGSLTISPVQKNSDSGVYTCWARNKQGHSARRSGEVTVIVPPKLS 615

Human   416 PDQWN---QETGEEERFALEILPDML---------------EKHYGYK--------LFIPDRDLI 454
            |.|.|   ...|:.......::...|               .:|...|        |.|.:....
  Fly   616 PFQTNILQLNMGDRASLTCSVVKGDLPLTINWRKDGRPIDPTQHMSVKQVDQYNSILVIENLGSD 680

Human   455 PTGTY---IEDVARCVDQSKRLIIVMTPNYVV 483
            .||.|   :.:.|..|:.|:.|::.:.|.::|
  Fly   681 HTGNYSCVVRNSAAEVENSQALLVNVPPRWIV 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IL1RAPL1NP_055086.1 Ig1_IL1RAPL-1_like 32..135 CDD:143304 23/111 (21%)
Ig 148..239 CDD:386229 27/103 (26%)
IGc2 260..341 CDD:197706 22/85 (26%)
TIR 405..559 CDD:366714 20/128 (16%)
Interaction with NCS1. /evidence=ECO:0000269|PubMed:12783849 549..644
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 659..680
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352 16/91 (18%)
Ig 247..327 CDD:299845 16/82 (20%)
I-set 332..418 CDD:254352 26/96 (27%)
IGc2 344..407 CDD:197706 22/73 (30%)
IG_like 432..517 CDD:214653 27/100 (27%)
IGc2 436..507 CDD:197706 22/86 (26%)
I-set 521..610 CDD:254352 17/97 (18%)
IGc2 533..597 CDD:197706 14/71 (20%)
Ig 630..699 CDD:143165 10/68 (15%)
IG_like 714..802 CDD:214653
Ig 725..802 CDD:299845
Ig 823..894 CDD:143165
FN3 906..1006 CDD:238020
FN3 1013..1111 CDD:238020
FN3 1119..1209 CDD:238020
FN3 1219..1313 CDD:238020
Ig 1336..1402 CDD:143165
FN3 1409..1498 CDD:238020
FN3 1515..1588 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.