DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTN2A1 and ed

DIOPT Version :9

Sequence 1:NP_008980.1 Gene:BTN2A1 / 11120 HGNCID:1136 Length:527 Species:Homo sapiens
Sequence 2:NP_001260013.1 Gene:ed / 33619 FlyBaseID:FBgn0000547 Length:1332 Species:Drosophila melanogaster


Alignment Length:250 Identity:62/250 - (24%)
Similarity:94/250 - (37%) Gaps:48/250 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    19 LLSLCALVSAQFIVVGPTDPILATVGENT--TLRCHLSPEKNAEDMEVRWFRSQFSPAVF----- 76
            |::|.||.|...     .|..:.| .||.  ||:|..:.:..|.|....|.|...:||.|     
  Fly    30 LIALVALSSTTL-----ADESIDT-RENADLTLKCRFNDKYEANDFSFFWTRWTANPAQFDNVAI 88

Human    77 --VYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNIT-AQENGTYRCYFQ---EGRSYDE 135
              |......|.:.|.|              ||...|.|.|:: .::||.:.|..:   .|....:
  Fly    89 GEVQLSSGYRLDFQPE--------------RGIYDLQIKNVSYNRDNGRFECRIKAKGTGADVHQ 139

Human   136 AILHLVVAGLGSKPLISMRGH-----EDGGIRLECISRGWYPKPLTVW-RDPYGGVAPA--LKEV 192
            ...:|.|......|:|| .|:     ||..:.|.|.|.|..|.|...| |:......||  ||..
  Fly   140 EFHNLTVLTPPHPPVIS-PGNIAVATEDKPMELTCSSIGGSPDPTITWYREGSNTPLPATVLKGG 203

Human   193 SMPDADGLFMVTTAVI-IRDKSVRNMSCSINNTLL--GQKKESVIFIPESFMPSV 244
            :   .|.....|.::| .|:.......|.:.|..:  |::.|:...:..::.|.|
  Fly   204 T---KDQPTNATLSIIPRREDDGAKYKCVVRNRAMNEGKRLEATATLNVNYYPRV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTN2A1NP_008980.1 IG_like 38..142 CDD:214653 27/116 (23%)
Ig_MOG_like 44..143 CDD:143190 26/111 (23%)
SPRY_PRY_BTN1_2 327..500 CDD:293991
edNP_001260013.1 Ig 50..147 CDD:299845 26/110 (24%)
I-set 146..249 CDD:254352 27/106 (25%)
Ig 168..249 CDD:299845 20/83 (24%)
IGc2 268..323 CDD:197706
Ig_3 341..406 CDD:290638
Ig_2 437..514 CDD:290606
I-set 526..633 CDD:254352
Ig 546..632 CDD:143165
IG_like 654..736 CDD:214653
Ig 656..734 CDD:143165
FN3 741..848 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.