DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTN3A1 and RGD1624210

DIOPT Version :9

Sequence 1:NP_008979.3 Gene:BTN3A1 / 11119 HGNCID:1138 Length:513 Species:Homo sapiens
Sequence 2:XP_038954996.1 Gene:RGD1624210 / 686977 RGDID:1624210 Length:548 Species:Rattus norvegicus


Alignment Length:509 Identity:187/509 - (36%)
Similarity:292/509 - (57%) Gaps:29/509 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    10 LLLNFRVCLLLLQL-LMPHSA------QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETM-ELK 66
            ::..||||.:...: |.|.:|      .|.|.|||.||:|.:|.:|.|||.:||.||.|.| ||:
  Rat    13 MIFFFRVCSVHCPVSLQPLTATSVSTEDFLVFGPSDPIVATLGGEAILPCSVFPVMSVENMEELR 77

Human    67 WVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDG 131
            |..:...:.|.||.|.:|.::.|...|..|||:::|....||||:||.||..||||.|:|:|:.|
  Rat    78 WFRTRFSEAVFVYRDQEEQKEGQLPGYSQRTSLVKDQFHEGKAAVRIQNVQESDSGIYVCHFKQG 142

Human   132 DFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVA 196
            .|:|:|::||||||:||...|.:||.::||:.:.|.::||||:||:.|.:::||::|.....:..
  Rat   143 HFHEEAILELKVAAMGSVPEVYIKGPEEGGVCVVCMTSGWYPEPQVHWRDSRGEDLPASSETLHE 207

Human   197 DGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGTLPVLLL 261
            |..||::...|:::|.||...|:|:..:.:||.||..::.|.:|||..|..|.|.::..|.::.:
  Rat   208 DAEGLFSTETSLVLRDSSVRNVTCSTFNPILGQEKAMAMVIPEPFFPQASPWKADISEILKMMQV 272

Human   262 LLGGAGYFLWQ------QQEEKKTQFRKKKREQELREMAWSTMKQEQSTRVKLLEELRWRSIQYA 320
            ||......|.:      :.:.|.:.|:.:|.|.::      |.:....|...|.|||..|...|.
  Rat   273 LLLLTSCLLMRAHSARLRLQWKWSHFQLEKDESQM------TKEDALRTASALREELDRRKAAYN 331

Human   321 SRGERHSAYNEWKKALFKPADVILDPKTANPILLVSEDQRSVQRAKEPQDLPDNPERFNWHYCVL 385
            ....:...|.:|:|..|:.....|||.:|:|.|::|:|:..|.|       .|.....:..:.||
  Rat   332 RAWRKAHLYADWRKEHFQTWTFTLDPGSAHPTLVISQDRMRVTR-------KDTIVCLDGLFSVL 389

Human   386 GCESFISGRHYWEVEV--GDRKEWHIGVCSKNVQRKGWVKMTPENGFWTMGLTDGNKYRTLTEPR 448
            |.:...|||:||||::  |:..:|.:|||.:.|:|||:...:||.||||:|.:....:..:...|
  Rat   390 GTKGISSGRYYWEVKLANGEGSKWILGVCREGVERKGFYFESPEKGFWTVGQSSCGYFAYVDRGR 454

Human   449 TNLKLPKPPKKVGVFLDYETGDISFYNAVDGSHIHTFLDVSFSEALYPVFRILT 502
            .:|.:.:.|:.||||:||:.|||||||..|.|||.:|...|.|..|.|.||:::
  Rat   455 ASLSIRQAPQSVGVFVDYDEGDISFYNMSDMSHIFSFHKASLSGTLLPYFRLMS 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTN3A1NP_008979.3 IG_like 37..143 CDD:214653 50/106 (47%)
Ig_MOG_like 45..144 CDD:143190 47/99 (47%)
SPRY_PRY_BTN3 337..512 CDD:293992 65/168 (39%)
RGD1624210XP_038954996.1 IgV_MOG_like 41..155 CDD:409378 55/113 (49%)
Ig strand B 58..62 CDD:409378 2/3 (67%)
Ig strand C 74..79 CDD:409378 2/4 (50%)
Ig strand E 120..124 CDD:409378 2/3 (67%)
Ig strand F 134..139 CDD:409378 2/4 (50%)
Ig strand G 147..150 CDD:409378 1/2 (50%)
Ig 158..242 CDD:416386 29/83 (35%)
SPRY_PRY_C-I_1 353..506 CDD:293968 63/159 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 137 1.000 Domainoid score I34658
eggNOG 1 0.900 - - E1_28KB3
HGNC 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
NCBI 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG39342
OrthoDB 1 1.010 - - D186278at7742
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X198
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.