Sequence 1: | NP_008979.3 | Gene: | BTN3A1 / 11119 | HGNCID: | 1138 | Length: | 513 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_723103.1 | Gene: | DIP-theta / 33795 | FlyBaseID: | FBgn0051646 | Length: | 606 | Species: | Drosophila melanogaster |
Alignment Length: | 245 | Identity: | 53/245 - (21%) |
---|---|---|---|
Similarity: | 93/245 - (37%) | Gaps: | 64/245 - (26%) |
- Green bases have known domain annotations that are detailed below.
Human 44 VGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGK 108
Human 109 AA--LRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGY--------KDG-GI 162
Human 163 HLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGV---GLYAVAASV--IMRGS----SGEGV 218
Human 219 SCT----------------IRSSLLGLEKTASISI---ADPFFRSAQRWI 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
BTN3A1 | NP_008979.3 | IG_like | 37..143 | CDD:214653 | 20/100 (20%) |
Ig_MOG_like | 45..144 | CDD:143190 | 19/100 (19%) | ||
SPRY_PRY_BTN3 | 337..512 | CDD:293992 | |||
DIP-theta | NP_723103.1 | Ig | 137..230 | CDD:299845 | 22/107 (21%) |
IG_like | 137..230 | CDD:214653 | 22/107 (21%) | ||
IG_like | 240..324 | CDD:214653 | 22/87 (25%) | ||
IGc2 | 247..310 | CDD:197706 | 20/66 (30%) | ||
Ig | 327..419 | CDD:299845 | 7/36 (19%) | ||
IG_like | 343..420 | CDD:214653 | 3/20 (15%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |