DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTN3A1 and DIP-theta

DIOPT Version :9

Sequence 1:NP_008979.3 Gene:BTN3A1 / 11119 HGNCID:1138 Length:513 Species:Homo sapiens
Sequence 2:NP_723103.1 Gene:DIP-theta / 33795 FlyBaseID:FBgn0051646 Length:606 Species:Drosophila melanogaster


Alignment Length:245 Identity:53/245 - (21%)
Similarity:93/245 - (37%) Gaps:64/245 - (26%)


- Green bases have known domain annotations that are detailed below.


Human    44 VGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGK 108
            |..:|.|.|   ...:.:|.::.|:....:.::.:.........|.|..:            |.|
  Fly   143 VSREAVLQC---VVDNLQTYKIAWLRVDTQTILTIQNHVITKNHRMSITH------------AEK 192

Human   109 AA--LRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGY--------KDG-GI 162
            .|  |||.:|..||.|.|:|......      ::.:|..|...:..|:..|        ::| .:
  Fly   193 RAWILRIRDVKESDKGWYMCQINTDP------MKSQVGYLDVVVPPDILDYPTSTDMVIREGSNV 251

Human   163 HLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGV---GLYAVAASV--IMRGS----SGEGV 218
            .|:|.:|| .|.|.|.|....||.||   .|..|:.|   |.:...|.|  :..|:    :..|:
  Fly   252 TLKCAATG-SPTPTITWRREGGELIP---LPNGAEAVAYNGSFLTIAKVNRLNMGAYLCIASNGI 312

Human   219 SCT----------------IRSSLLGLEKTASISI---ADPFFRSAQRWI 249
            ..|                |::.|:|...|.:|::   ::.:.:|...|:
  Fly   313 PPTVSKRVMLIVHFPPMIWIQNQLVGAALTQNITLECQSEAYPKSINYWM 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTN3A1NP_008979.3 IG_like 37..143 CDD:214653 20/100 (20%)
Ig_MOG_like 45..144 CDD:143190 19/100 (19%)
SPRY_PRY_BTN3 337..512 CDD:293992
DIP-thetaNP_723103.1 Ig 137..230 CDD:299845 22/107 (21%)
IG_like 137..230 CDD:214653 22/107 (21%)
IG_like 240..324 CDD:214653 22/87 (25%)
IGc2 247..310 CDD:197706 20/66 (30%)
Ig 327..419 CDD:299845 7/36 (19%)
IG_like 343..420 CDD:214653 3/20 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.