DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTN3A1 and DIP-eta

DIOPT Version :9

Sequence 1:NP_008979.3 Gene:BTN3A1 / 11119 HGNCID:1138 Length:513 Species:Homo sapiens
Sequence 2:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:290 Identity:59/290 - (20%)
Similarity:109/290 - (37%) Gaps:68/290 - (23%)


- Green bases have known domain annotations that are detailed below.


Human     2 KMASFLAFLLLNFRVCLLLLQLLMPHSAQFS---VLGP--SGPILAM---VGEDADLPC---HLF 55
            |....|:.:||    .:|:.|...|...:..   ::.|  |.||:.|   ||.||.|.|   .|.
  Fly    10 KQTCALSVILL----LILMSQQCYPQRVEVPAEVIVDPKFSSPIVNMTAPVGRDAFLTCVVQDLG 70

Human    56 PTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKA---ALRIHNVT 117
            |      .::.|:....:.::.:  ....:...|           |.||...:.   .:||.::.
  Fly    71 P------YKVAWLRVDTQTILTI--QNHVITKNQ-----------RIGIANSEHKTWTMRIKDIK 116

Human   118 ASDSGKYLCYFQDGDFYEKALVELKVAA----LGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQ 178
            .||.|.|:|.. :.|..:..:..|.|..    |......|:...:...:.|:|.:|| .|:|.|.
  Fly   117 ESDKGWYMCQI-NTDPMKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVTLKCAATG-SPEPTIT 179

Human   179 WSNNK--------GENIPTVEAP------VVADGVGLYAVAASVIMRGSSGEGVS--------CT 221
            |....        ||.:.::|..      |....:|.|...||..:..|..:.::        .|
  Fly   180 WRRESGVPIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVVHFPPMIT 244

Human   222 IRSSLLGLEKTASISI---ADPFFRSAQRW 248
            :::.|:|..:...:::   ::.:.:|...|
  Fly   245 VQNQLIGAVEGKGVTLDCESEAYPKSINYW 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTN3A1NP_008979.3 IG_like 37..143 CDD:214653 26/114 (23%)
Ig_MOG_like 45..144 CDD:143190 21/104 (20%)
SPRY_PRY_BTN3 337..512 CDD:293992
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 23/109 (21%)
IG_like 51..137 CDD:214653 22/105 (21%)
IG_like 153..237 CDD:214653 18/84 (21%)
Ig 161..224 CDD:299845 16/63 (25%)
IG_like 252..335 CDD:214653 2/23 (9%)
Ig 258..333 CDD:143165 2/17 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.