DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BTN3A1 and DIP-beta

DIOPT Version :9

Sequence 1:NP_008979.3 Gene:BTN3A1 / 11119 HGNCID:1138 Length:513 Species:Homo sapiens
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:245 Identity:54/245 - (22%)
Similarity:90/245 - (36%) Gaps:49/245 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    18 LLLLQLL-----MPHSAQFSVLGPSGP--------ILAMVGEDADLPC--------HLFPTMSAE 61
            ||||.||     :..|.:.|.:|...|        :....|.||...|        .:....|:.
  Fly    72 LLLLLLLGNCIDLTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSA 136

Human    62 TMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLC 126
            ..::.|:.:..:.::.::.......||.|..:....:          ..|.|..|...|:|||:|
  Fly   137 PAKVAWIKADAKAILAIHEHVITNNDRLSVQHNDYNT----------WTLNIRGVKMEDAGKYMC 191

Human   127 YFQ-DGDFYEKALVELKVA--ALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIP 188
            ... |....:.|.:|:.:.  .:..:...|:...:.|...|.||:.| :|:|:|.|....|..| 
  Fly   192 QVNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARG-HPKPKITWRREDGREI- 254

Human   189 TVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIA 238
                 :..:|......|.||       ||...|: |.:...|..|.:.||
  Fly   255 -----IARNGSHQKTKAQSV-------EGEMLTL-SKITRSEMGAYMCIA 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BTN3A1NP_008979.3 IG_like 37..143 CDD:214653 21/122 (17%)
Ig_MOG_like 45..144 CDD:143190 20/107 (19%)
SPRY_PRY_BTN3 337..512 CDD:293992
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 21/120 (18%)
ig 102..195 CDD:278476 17/102 (17%)
IG_like 219..307 CDD:214653 24/88 (27%)
Ig 221..307 CDD:299845 24/86 (28%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.