DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHEK1 and AMPKalpha

DIOPT Version :9

Sequence 1:XP_011540862.1 Gene:CHEK1 / 1111 HGNCID:1925 Length:492 Species:Homo sapiens
Sequence 2:NP_477313.1 Gene:AMPKalpha / 43904 FlyBaseID:FBgn0023169 Length:582 Species:Drosophila melanogaster


Alignment Length:440 Identity:111/440 - (25%)
Similarity:170/440 - (38%) Gaps:117/440 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   118 MPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNK 182
            :.|..|:|||.|:::||.|.|...|.|||:||||||||...::||:||||:.:....   ..|..
  Fly   123 LQEHQARRFFQQIISGVDYCHRHMIVHRDLKPENLLLDHNMHVKIADFGLSNMMLDG---EFLRT 184

Human   183 MCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKK------ 241
            .||:..|.|||::..:.:....||:||||::|.|:|.|.||:|      .|:.....:|      
  Fly   185 SCGSPNYAAPEVISGKLYAGPEVDIWSCGVILYALLCGTLPFD------DEHVPTLFRKIKSGIF 243

Human   242 ---TYLNPWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPL------------------ 285
               .|||  |::    :.|:.::|..:|..|..|.:|||..|:.|.|                  
  Fly   244 PIPEYLN--KQV----VNLVCQMLQVDPLKRANIEEIKKHEWFQKDLPAYLFPSSIEQDSNVIDT 302

Human   286 --------KKGAKRPRVTSGGVSESPS---GFSKH-IQSNLDFS--PVNSASSEENVKYSSSQPE 336
                    |.|.|...|.:..:|..|.   ..:.| |..|..|:  ..|..:...|...:.|.|.
  Fly   303 YAVAEVCTKFGVKETEVHNSLLSGDPHDQLAIAYHLIIDNKRFADDAANQINEINNFFVAGSPPP 367

Human   337 PRT---------------------GLSLWDTSPSYIDKLVQGI-SFSQPTCP---------DHML 370
            |..                     |.|....:.:.:..:..|. |.:.|..|         |..|
  Fly   368 PPPPPVPQSSMDHQAPLATVTVGGGTSASSGTATPVPPVAGGTPSSTIPIRPHPERIAPMRDRQL 432

Human   371 LNSQLLGTPGSSQNPWQRLVKRMTRFFTKLDADK-----------------SYQCLKETCEKLGY 418
            ..|  :.|.|....|     ::..|..|.:...|                 .|:.:|    .|.|
  Fly   433 AMS--VQTSGGGAFP-----EKTARGGTPIKRAKWHLGIRSQSKPNDIMLEVYRAMK----ALSY 486

Human   419 QWKKSCMNQVTISTTDRRNNKLI-FKVNLLEMDDK-ILVDFRLSKGDGLE 466
            :||......|.:...:.:..|.. ..:.|.::|.| .|:||:....|.:|
  Fly   487 EWKIINPYHVRVRRQNVKTGKFSKMSLQLYQVDAKSYLLDFKSLTNDEVE 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHEK1XP_011540862.1 PKc_like <114..281 CDD:304357 62/171 (36%)
S_TKc <117..280 CDD:214567 62/170 (36%)
AMPKalphaNP_477313.1 STKc_AMPK_alpha 25..280 CDD:270981 62/171 (36%)
UBA_AID_AMPKalpha 297..360 CDD:270521 12/62 (19%)
AMPKA_C 457..580 CDD:213378 17/84 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.