DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PRDM5 and CG2889

DIOPT Version :9

Sequence 1:NP_001366033.1 Gene:PRDM5 / 11107 HGNCID:9349 Length:641 Species:Homo sapiens
Sequence 2:NP_001245615.1 Gene:CG2889 / 31977 FlyBaseID:FBgn0030206 Length:581 Species:Drosophila melanogaster


Alignment Length:407 Identity:99/407 - (24%)
Similarity:151/407 - (37%) Gaps:82/407 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   125 DSDMEAEEEEQQIMTVIKEGEVENSRRQSTAGRKDRLGCKEDYACPQCESS--FTSEDILAEHLQ 187
            |.....|.:|.::..|::......||.|.....:..:......:|..||.|  :.||  |..|..
  Fly   232 DQRTTTESQESELQAVLERKPKGCSRAQLAKSYEKAIASYMSASCDLCEFSAPYLSE--LKTHFL 294

Human   188 TLHQKPTEEKEFKCKNCGKKFPVKQALQRHVLQCTAKSSLKESSRSFQCSVCNSSFSSASSFEQH 252
            .:||     :|:..|.|||.|.....|..|:.:       ..:.:.|.|::|.            
  Fly   295 EVHQ-----REYYIKCCGKVFTRASKLMDHIRK-------HINPKLFTCTICK------------ 335

Human   253 QETCRGDARFVCKADSCGKRLKSKDALKRHQENVHTGDPKKKLICSVCNKKCSSASSLQEHRKIH 317
                              |.|.|:|.|..|.|.||             ||.......|:      
  Fly   336 ------------------KSLNSQDYLATHIETVH-------------NKVAQIGKVLK------ 363

Human   318 EIFDCQECMKKFISANQLKRHMITHSDMRLSPLIFLIEKRPYNCEICNKSFKRLDQVGAH-KVIH 381
              |.|.:|.:.|.|..::..|:..|...:|.          :.||||.|||..:.::..| :.||
  Fly   364 --FPCPKCERTFSSERRMANHLAKHDTDQLE----------HTCEICCKSFANVHRLRRHIQSIH 416

Human   382 SEDKPYKCKLCGKGFAHRNVYKNHKKTHS--EERPFQCEECKALFRTPFSLQRHLLIHNSERTFK 444
            .:...:.|.:|||.|..:..::.|...|.  .....:|..|:...:...||:.|...|:|..|. 
  Fly   417 EDLHRHVCDICGKKFKFKPSFERHLLEHQGVVAPAVECPICRVWLKNEHSLRLHRFTHDSTDTV- 480

Human   445 CHHCDATFKRKDTLNVHVQVVHERHKKYRCELCNKAFVTPSVLRSHKKTHTGEKEKICPYCGQKF 509
            |.||..|...:..|..||:..|:.....:|..|.|.|.....|..|...|||.:...||:|.::.
  Fly   481 CPHCGKTCTSRTALRGHVKYAHKLTTNLQCTFCEKTFKQQRNLDEHMAIHTGLQLYNCPHCPKEC 545

Human   510 ASSGTLRVHIRS-HTGE 525
            .|...:.|||:. |..|
  Fly   546 RSRSNMYVHIKQRHADE 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PRDM5NP_001366033.1 PR-SET_PRDM5 2..128 CDD:380967 1/2 (50%)
COG5048 <145..338 CDD:227381 41/194 (21%)
C2H2 Zn finger 169..190 CDD:275368 8/22 (36%)
C2H2 Zn finger 201..221 CDD:275368 7/19 (37%)
C2H2 Zn finger 236..256 CDD:275368 2/19 (11%)
COG5048 262..631 CDD:227381 71/268 (26%)
C2H2 Zn finger 264..287 CDD:275368 7/22 (32%)
C2H2 Zn finger 297..317 CDD:275368 3/19 (16%)
C2H2 Zn finger 322..342 CDD:275368 5/19 (26%)
C2H2 Zn finger 361..381 CDD:275368 8/20 (40%)
C2H2 Zn finger 389..409 CDD:275368 6/19 (32%)
C2H2 Zn finger 417..437 CDD:275368 5/19 (26%)
C2H2 Zn finger 445..462 CDD:275368 5/16 (31%)
C2H2 Zn finger 474..494 CDD:275368 6/19 (32%)
C2H2 Zn finger 502..522 CDD:275368 7/20 (35%)
C2H2 Zn finger 530..550 CDD:275368
C2H2 Zn finger 558..578 CDD:275368
C2H2 Zn finger 586..606 CDD:275368
C2H2 Zn finger 615..636 CDD:275368
CG2889NP_001245615.1 zf-AD 2..79 CDD:285071
C2H2 Zn finger 276..297 CDD:275368 8/22 (36%)
C2H2 Zn finger 306..323 CDD:275368 6/23 (26%)
C2H2 Zn finger 331..352 CDD:275368 9/50 (18%)
C2H2 Zn finger 366..386 CDD:275368 5/19 (26%)
C2H2 Zn finger 395..416 CDD:275368 8/20 (40%)
C2H2 Zn finger 424..444 CDD:275368 6/19 (32%)
C2H2 Zn finger 481..502 CDD:275368 7/20 (35%)
C2H2 Zn finger 510..530 CDD:275368 6/19 (32%)
C2H2 Zn finger 538..556 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.