DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADCY5 and Gyc89Da

DIOPT Version :9

Sequence 1:NP_001365188.1 Gene:ADCY5 / 111 HGNCID:236 Length:1286 Species:Homo sapiens
Sequence 2:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster


Alignment Length:547 Identity:139/547 - (25%)
Similarity:239/547 - (43%) Gaps:136/547 - (24%)


- Green bases have known domain annotations that are detailed below.


Human   813 VKLFPSPLQTLSR------------KIVRSKMNSTLVGVFTITL-VFLAAFVNMFTCNSRDLLGC 864
            :||...||..:.:            |.|.::.:.:.:.:.|:.| |||..|...|..|       
  Fly   179 IKLTDGPLTVIVKYRLDFDNREYMAKRVNTEAHPSQLKMPTVKLDVFLDLFPFTFVLN------- 236

Human   865 LAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSPWPNCNFPEYFTYSVLLSLLAC-------- 921
                |::..:     |..|..|      |.....:|..|   |:.|..:.::.|..|        
  Fly   237 ----HDMKIT-----HAGEKIV------ETWIMHNPGAN---PKSFIGTHVMDLFQCRRPKDTTI 283

Human   922 --SVFLQISCIGKLVLMLAIELI--------YVLIVEVPGVTLFDN--------ADLLVTANAID 968
              ...:|:..:     :...|||        |..::.:.    |:|        |..:..|.|.:
  Fly   284 DWDTLIQMRAV-----LFEFELIRTGHNRAAYDAVLNMD----FENYDEMDLNEAQTMALAKAQE 339

Human   969 FFNNGTSQWSLCENLRHRRMEAGTYFPSGVKEQSPEHATKVALK--------------VVTPIII 1019
            |..:......  |:.|...::     |:..:.:|.:....:.||              :.:|:|.
  Fly   340 FSESHPVDDD--ESAREDEID-----PATGERRSSQGLRSILLKGQMFYIKDVDSLIFLCSPLIE 397

Human  1020 SVFVL---ALYLHAQQVESTARLDFL--W----KLQATEEKEEM--EELQ-------AYNRR--- 1063
            ::..|   .|||:.......:|...:  |    ||:...||||.  :||:       ::.|:   
  Fly   398 NLDELHGIGLYLNDLNPHGLSRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDE 462

Human  1064 LLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVE-LEANNEGVECLRLLNE 1127
            ||::::|:.:|    .|.|.::|...||.|.|:|:|..:.|   .|.| |.:....::.:..||:
  Fly   463 LLYSMIPRPIA----ERMRLSEEQVCQSFEEVSVIFLEVMN---VYDEGLNSIQGAMQTVNTLNK 520

Human  1128 IIADFD-EIISEDRFRQLEKIKTIGSTYMAASGLNDSTYDKVGKTHIKALADFAMKLMDQMKYIN 1191
            :.:..| ||||...:    |::|:|..|||.||..|     |...|.:...|.|:::|.:.|   
  Fly   521 VFSALDEEIISPFVY----KVETVGMVYMAVSGAPD-----VNPLHAEHACDLALRVMKKFK--- 573

Human  1192 EHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDMYQVLAAN 1256
            .|...:..:::|:|.|||||||:|.:.|:|.::|:|||.||||:|:..|.:||::......:...
  Fly   574 AHDMGDVAIRVGINSGPVVAGVVGQKVPRYCLFGDTVNTASRMESSSDPWKIQLSKYTGDKVRQV 638

Human  1257 TYQLECRGVVKVKGKGEMMTYFLNGGP 1283
            .|::|.||.|:|||||:|.||:|..||
  Fly   639 GYKVESRGTVQVKGKGDMETYWLLEGP 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADCY5NP_001365188.1 AC_N 1..458 CDD:318454
Guanylate_cyc 460..633 CDD:306677
DUF1053 668..760 CDD:399378
Guanylate_cyc 1087..1281 CDD:306677 71/195 (36%)
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 57/302 (19%)
CYCc 457..643 CDD:214485 66/204 (32%)
Guanylate_cyc 485..662 CDD:278633 70/191 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.