DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADCY5 and CG31183

DIOPT Version :9

Sequence 1:NP_001365188.1 Gene:ADCY5 / 111 HGNCID:236 Length:1286 Species:Homo sapiens
Sequence 2:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster


Alignment Length:244 Identity:78/244 - (31%)
Similarity:132/244 - (54%) Gaps:35/244 - (14%)


- Green bases have known domain annotations that are detailed below.


Human  1049 EEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELE 1113
            |||::.|       :||:.:||:.|||..::.:....|.:.|    |.:.|:.|..|:    .:.
  Fly   917 EEKKKCE-------KLLYQLLPQSVAAQLISGQPVVAETFDQ----VTIYFSDIVGFT----AIS 966

Human  1114 ANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTYDKVGKTHIKALAD 1178
            |.:..::.::.||::...||.|:  :.| .:.|::|||..||..|||.    .:.|..|.:.:|.
  Fly   967 AESTPMQVVQFLNDLYTCFDSIV--ENF-DVYKVETIGDAYMVVSGLP----IRNGNQHAREIAR 1024

Human  1179 FAMKLMDQMKYINEHSF-------NNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDS 1236
            .|:.|::.:     |:|       :..:::|||:.|..||||:|.:.|:|.::|:|||.||||:|
  Fly  1025 LALALLEAV-----HNFRIHHRPEDRLKLRIGLHTGACVAGVVGLKMPRYCLFGDTVNTASRMES 1084

Human  1237 TGVPDRIQVTTDMYQVL-AANTYQLECRGVVKVKGKGEMMTYFLNGGPP 1284
            .|...:|.::....:.| ...|:....||.|.:||||||:||:|.|..|
  Fly  1085 NGEALKIHISETTKEALDEFGTFVTTRRGFVPMKGKGEMLTYWLEGEVP 1133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADCY5NP_001365188.1 AC_N 1..458 CDD:318454
Guanylate_cyc 460..633 CDD:306677
DUF1053 668..760 CDD:399378
Guanylate_cyc 1087..1281 CDD:306677 64/201 (32%)
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 11/27 (41%)
CYCc 917..1108 CDD:214485 64/217 (29%)
Guanylate_cyc 944..1130 CDD:278633 65/205 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.